Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3039659..3040276 Replicon chromosome
Accession NZ_CP103401
Organism Pantoea agglomerans strain CHTF15

Toxin (Protein)


Gene name Hha Uniprot ID E0LTU7
Locus tag NYF24_RS14345 Protein ID WP_003850458.1
Coordinates 3040061..3040276 (+) Length 72 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID E0LTU8
Locus tag NYF24_RS14340 Protein ID WP_003850455.1
Coordinates 3039659..3040036 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYF24_RS14310 (3035966) 3035966..3036220 + 255 WP_010671219.1 type B 50S ribosomal protein L31 -
NYF24_RS14315 (3036232) 3036232..3036372 + 141 WP_010255896.1 type B 50S ribosomal protein L36 -
NYF24_RS14320 (3036418) 3036418..3037296 - 879 WP_010255893.1 metal ABC transporter substrate-binding protein -
NYF24_RS14325 (3037312) 3037312..3038151 - 840 WP_010255890.1 metal ABC transporter permease -
NYF24_RS14330 (3038148) 3038148..3038816 - 669 WP_258992602.1 ABC transporter ATP-binding protein -
NYF24_RS14335 (3039158) 3039158..3039511 + 354 WP_031592173.1 hypothetical protein -
NYF24_RS14340 (3039659) 3039659..3040036 + 378 WP_003850455.1 Hha toxicity modulator TomB Antitoxin
NYF24_RS14345 (3040061) 3040061..3040276 + 216 WP_003850458.1 HHA domain-containing protein Toxin
NYF24_RS14355 (3040684) 3040684..3040995 + 312 WP_010255882.1 MGMT family protein -
NYF24_RS14360 (3041035) 3041035..3041592 - 558 WP_010255881.1 YbaY family lipoprotein -
NYF24_RS14365 (3041783) 3041783..3042646 + 864 WP_045140707.1 acyl-CoA thioesterase II -
NYF24_RS14370 (3042696) 3042696..3043982 - 1287 WP_010255877.1 ammonium transporter AmtB -
NYF24_RS14375 (3044017) 3044017..3044355 - 339 WP_003850469.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(12-68)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 72 a.a.        Molecular weight: 8510.90 Da        Isoelectric Point: 9.4825

>T254996 WP_003850458.1 NZ_CP103401:3040061-3040276 [Pantoea agglomerans]
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR

Download         Length: 216 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14636.25 Da        Isoelectric Point: 4.3976

>AT254996 WP_003850455.1 NZ_CP103401:3039659-3040036 [Pantoea agglomerans]
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGVNSPDLQRWQRSAKRLFNLFTEECAFLQQPSHSL

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I5AGC3

Antitoxin

Source ID Structure
AlphaFold DB A0A1I5AG55

References