Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1376514..1377430 | Replicon | chromosome |
Accession | NZ_CP103352 | ||
Organism | Bacillus subtilis strain SRCM117508 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | NX823_RS07125 | Protein ID | WP_003244695.1 |
Coordinates | 1376684..1377430 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | NX823_RS07120 | Protein ID | WP_003232646.1 |
Coordinates | 1376514..1376684 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX823_RS07085 (NX823_07085) | 1373373..1373702 | + | 330 | WP_046160312.1 | XkdW family protein | - |
NX823_RS07090 (NX823_07090) | 1373699..1373863 | + | 165 | WP_014479563.1 | XkdX family protein | - |
NX823_RS07095 (NX823_07095) | 1373910..1374749 | + | 840 | WP_014479564.1 | phage-like element PBSX protein XepA | - |
NX823_RS07100 (NX823_07100) | 1374802..1375071 | + | 270 | WP_014479565.1 | hemolysin XhlA family protein | - |
NX823_RS07105 (NX823_07105) | 1375084..1375347 | + | 264 | WP_014479566.1 | phage holin | - |
NX823_RS07110 (NX823_07110) | 1375360..1376253 | + | 894 | WP_258996659.1 | N-acetylmuramoyl-L-alanine amidase | - |
NX823_RS07115 (NX823_07115) | 1376291..1376428 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NX823_RS07120 (NX823_07120) | 1376514..1376684 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
NX823_RS07125 (NX823_07125) | 1376684..1377430 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NX823_RS07130 (NX823_07130) | 1377540..1378541 | - | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
NX823_RS07135 (NX823_07135) | 1378554..1379171 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
NX823_RS07140 (NX823_07140) | 1379447..1380763 | - | 1317 | WP_014479570.1 | serine/threonine exchanger | - |
NX823_RS07145 (NX823_07145) | 1381152..1382102 | + | 951 | WP_014479571.1 | ring-cleaving dioxygenase | - |
NX823_RS07150 (NX823_07150) | 1382211..1382306 | + | 96 | Protein_1345 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1337048..1385794 | 48746 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T254988 WP_003244695.1 NZ_CP103352:c1377430-1376684 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|