Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 530861..531497 | Replicon | chromosome |
Accession | NZ_CP103352 | ||
Organism | Bacillus subtilis strain SRCM117508 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NX823_RS02645 | Protein ID | WP_003156187.1 |
Coordinates | 531147..531497 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | NX823_RS02640 | Protein ID | WP_003225183.1 |
Coordinates | 530861..531142 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX823_RS02620 (NX823_02620) | 527220..527819 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
NX823_RS02625 (NX823_02625) | 527914..528279 | + | 366 | WP_014478897.1 | holo-ACP synthase | - |
NX823_RS02630 (NX823_02630) | 528445..529461 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
NX823_RS02635 (NX823_02635) | 529576..530745 | + | 1170 | WP_015252766.1 | alanine racemase | - |
NX823_RS02640 (NX823_02640) | 530861..531142 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NX823_RS02645 (NX823_02645) | 531147..531497 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NX823_RS02650 (NX823_02650) | 531602..532426 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
NX823_RS02655 (NX823_02655) | 532431..532796 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
NX823_RS02660 (NX823_02660) | 532800..533201 | + | 402 | WP_017697001.1 | serine/threonine-protein kinase RsbT | - |
NX823_RS02665 (NX823_02665) | 533213..534220 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
NX823_RS02670 (NX823_02670) | 534282..534611 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
NX823_RS02675 (NX823_02675) | 534608..535090 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
NX823_RS02680 (NX823_02680) | 535056..535844 | + | 789 | Protein_486 | RNA polymerase sigma factor SigB | - |
NX823_RS02685 (NX823_02685) | 535844..536443 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T254987 WP_003156187.1 NZ_CP103352:531147-531497 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|