Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1373073..1373989 | Replicon | chromosome |
Accession | NZ_CP103351 | ||
Organism | Bacillus subtilis strain SRCM115947 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | NX819_RS07300 | Protein ID | WP_003244695.1 |
Coordinates | 1373243..1373989 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | NX819_RS07295 | Protein ID | WP_003232646.1 |
Coordinates | 1373073..1373243 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX819_RS07260 (NX819_07260) | 1369936..1370265 | + | 330 | WP_003232660.1 | XkdW family protein | - |
NX819_RS07265 (NX819_07265) | 1370262..1370426 | + | 165 | WP_003232658.1 | XkdX family protein | - |
NX819_RS07270 (NX819_07270) | 1370470..1371309 | + | 840 | WP_041850926.1 | phage-like element PBSX protein XepA | - |
NX819_RS07275 (NX819_07275) | 1371362..1371631 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
NX819_RS07280 (NX819_07280) | 1371644..1371907 | + | 264 | WP_003232653.1 | phage holin | - |
NX819_RS07285 (NX819_07285) | 1371920..1372813 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
NX819_RS07290 (NX819_07290) | 1372850..1372987 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NX819_RS07295 (NX819_07295) | 1373073..1373243 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
NX819_RS07300 (NX819_07300) | 1373243..1373989 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NX819_RS07305 (NX819_07305) | 1374099..1375100 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
NX819_RS07310 (NX819_07310) | 1375113..1375730 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
NX819_RS07315 (NX819_07315) | 1376006..1377322 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
NX819_RS07320 (NX819_07320) | 1377711..1378661 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
NX819_RS07325 (NX819_07325) | 1378762..1378908 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T254984 WP_003244695.1 NZ_CP103351:c1373989-1373243 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|