Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 571294..571930 | Replicon | chromosome |
Accession | NZ_CP103351 | ||
Organism | Bacillus subtilis strain SRCM115947 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NX819_RS03020 | Protein ID | WP_003156187.1 |
Coordinates | 571580..571930 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | NX819_RS03015 | Protein ID | WP_003225183.1 |
Coordinates | 571294..571575 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX819_RS02995 (NX819_02995) | 567653..568252 | - | 600 | WP_032722928.1 | rhomboid family intramembrane serine protease | - |
NX819_RS03000 (NX819_03000) | 568347..568712 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
NX819_RS03005 (NX819_03005) | 568878..569894 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
NX819_RS03010 (NX819_03010) | 570009..571178 | + | 1170 | WP_015252766.1 | alanine racemase | - |
NX819_RS03015 (NX819_03015) | 571294..571575 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NX819_RS03020 (NX819_03020) | 571580..571930 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NX819_RS03025 (NX819_03025) | 572045..572869 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
NX819_RS03030 (NX819_03030) | 572874..573239 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
NX819_RS03035 (NX819_03035) | 573243..573644 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
NX819_RS03040 (NX819_03040) | 573656..574663 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
NX819_RS03045 (NX819_03045) | 574725..575054 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
NX819_RS03050 (NX819_03050) | 575051..575533 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
NX819_RS03055 (NX819_03055) | 575499..576287 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
NX819_RS03060 (NX819_03060) | 576287..576886 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T254983 WP_003156187.1 NZ_CP103351:571580-571930 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|