Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1321256..1322172 | Replicon | chromosome |
Accession | NZ_CP103350 | ||
Organism | Bacillus subtilis strain SRCM117108 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | NX810_RS06935 | Protein ID | WP_003244695.1 |
Coordinates | 1321426..1322172 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | NX810_RS06930 | Protein ID | WP_003232646.1 |
Coordinates | 1321256..1321426 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX810_RS06895 (1318122) | 1318122..1318448 | + | 327 | WP_029727046.1 | XkdW family protein | - |
NX810_RS06900 (1318445) | 1318445..1318609 | + | 165 | WP_014479563.1 | XkdX family protein | - |
NX810_RS06905 (1318653) | 1318653..1319492 | + | 840 | WP_029727045.1 | phage-like element PBSX protein XepA | - |
NX810_RS06910 (1319545) | 1319545..1319814 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
NX810_RS06915 (1319827) | 1319827..1320090 | + | 264 | WP_014479566.1 | phage holin | - |
NX810_RS06920 (1320103) | 1320103..1320996 | + | 894 | WP_029727044.1 | N-acetylmuramoyl-L-alanine amidase | - |
NX810_RS06925 (1321033) | 1321033..1321170 | - | 138 | WP_119899277.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NX810_RS06930 (1321256) | 1321256..1321426 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
NX810_RS06935 (1321426) | 1321426..1322172 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NX810_RS06940 (1322282) | 1322282..1323283 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
NX810_RS06945 (1323296) | 1323296..1323913 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
NX810_RS06950 (1324189) | 1324189..1325505 | - | 1317 | WP_015252262.1 | serine/threonine exchanger | - |
NX810_RS06955 (1325893) | 1325893..1326843 | + | 951 | WP_003232637.1 | VOC family protein | - |
NX810_RS06960 (1326952) | 1326952..1327047 | + | 96 | Protein_1307 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1285798..1342617 | 56819 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T254976 WP_003244695.1 NZ_CP103350:c1322172-1321426 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|