Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 150516..151063 | Replicon | plasmid p1 |
| Accession | NZ_CP103347 | ||
| Organism | Brucella anthropi strain CGMCC 1.17299 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | NW321_RS23500 | Protein ID | WP_151610665.1 |
| Coordinates | 150516..150809 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | NW321_RS23505 | Protein ID | WP_151610664.1 |
| Coordinates | 150809..151063 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW321_RS23480 (NW321_23480) | 145814..146896 | - | 1083 | WP_151649008.1 | FAD-binding oxidoreductase | - |
| NW321_RS23485 (NW321_23485) | 146906..147943 | - | 1038 | WP_151610686.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
| NW321_RS23490 (NW321_23490) | 148069..148986 | + | 918 | WP_151610692.1 | LysR family transcriptional regulator | - |
| NW321_RS23495 (NW321_23495) | 149633..150346 | - | 714 | WP_259030569.1 | IS6 family transposase | - |
| NW321_RS23500 (NW321_23500) | 150516..150809 | - | 294 | WP_151610665.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NW321_RS23505 (NW321_23505) | 150809..151063 | - | 255 | WP_151610664.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| NW321_RS23510 (NW321_23510) | 151247..152191 | - | 945 | WP_151610663.1 | ornithine cyclodeaminase | - |
| NW321_RS23515 (NW321_23515) | 152201..152953 | - | 753 | WP_192799582.1 | amino acid ABC transporter ATP-binding protein | - |
| NW321_RS23520 (NW321_23520) | 152977..153903 | - | 927 | WP_151610661.1 | amino acid ABC transporter permease | - |
| NW321_RS23525 (NW321_23525) | 154059..154934 | - | 876 | WP_113534077.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..253576 | 253576 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11159.93 Da Isoelectric Point: 6.0740
>T254973 WP_151610665.1 NZ_CP103347:c150809-150516 [Brucella anthropi]
MEFKLSVLAEDDIIAIAEQGIAMFGPVQAKRYHAELFNTLDLIAKNPQMARAREEISPPVRVHPFKAHLIIYQIEADGTV
FVIRVRHAFEDWVRDPF
MEFKLSVLAEDDIIAIAEQGIAMFGPVQAKRYHAELFNTLDLIAKNPQMARAREEISPPVRVHPFKAHLIIYQIEADGTV
FVIRVRHAFEDWVRDPF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|