Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1651762..1652393 | Replicon | chromosome |
| Accession | NZ_CP103346 | ||
| Organism | Brucella anthropi strain CGMCC 1.17299 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A256GHB5 |
| Locus tag | NW321_RS21780 | Protein ID | WP_029928525.1 |
| Coordinates | 1651762..1652163 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A256GGW7 |
| Locus tag | NW321_RS21785 | Protein ID | WP_010660354.1 |
| Coordinates | 1652163..1652393 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW321_RS21760 (NW321_21760) | 1647199..1648719 | - | 1521 | WP_151664370.1 | FAD-dependent oxidoreductase | - |
| NW321_RS21765 (NW321_21765) | 1648849..1649790 | - | 942 | WP_226622753.1 | LysR substrate-binding domain-containing protein | - |
| NW321_RS21770 (NW321_21770) | 1649915..1651075 | - | 1161 | WP_151616616.1 | mandelate racemase/muconate lactonizing enzyme family protein | - |
| NW321_RS21775 (NW321_21775) | 1651104..1651358 | - | 255 | WP_151664369.1 | hypothetical protein | - |
| NW321_RS21780 (NW321_21780) | 1651762..1652163 | - | 402 | WP_029928525.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NW321_RS21785 (NW321_21785) | 1652163..1652393 | - | 231 | WP_010660354.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NW321_RS21790 (NW321_21790) | 1652926..1653171 | + | 246 | WP_010660453.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
| NW321_RS21795 (NW321_21795) | 1653171..1653467 | + | 297 | WP_010660454.1 | CcdB family protein | - |
| NW321_RS21800 (NW321_21800) | 1654304..1654930 | + | 627 | WP_192798608.1 | FliH/SctL family protein | - |
| NW321_RS21805 (NW321_21805) | 1655165..1656733 | + | 1569 | Protein_1527 | IS21 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15055.14 Da Isoelectric Point: 6.8629
>T254972 WP_029928525.1 NZ_CP103346:c1652163-1651762 [Brucella anthropi]
MLKYMLDTNICIFTIKNRPQQVREAFNRFHDQLCISSVSLMELIYGAEKSAHPEKNLAVVEGFAARLEVLSYDEPAANHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLIIVTNNRREFDRVPGLRVEDWTD
MLKYMLDTNICIFTIKNRPQQVREAFNRFHDQLCISSVSLMELIYGAEKSAHPEKNLAVVEGFAARLEVLSYDEPAANHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLIIVTNNRREFDRVPGLRVEDWTD
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A256GHB5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A256GGW7 |