Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1637901..1638475 | Replicon | chromosome |
Accession | NZ_CP103346 | ||
Organism | Brucella anthropi strain CGMCC 1.17299 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NW321_RS21715 | Protein ID | WP_151576612.1 |
Coordinates | 1638098..1638475 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A849KU45 |
Locus tag | NW321_RS21710 | Protein ID | WP_010660355.1 |
Coordinates | 1637901..1638101 (+) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW321_RS21695 (NW321_21695) | 1633521..1634114 | - | 594 | WP_010660339.1 | biliverdin-producing heme oxygenase | - |
NW321_RS21700 (NW321_21700) | 1634165..1634848 | - | 684 | WP_235693250.1 | Crp/Fnr family transcriptional regulator | - |
NW321_RS21705 (NW321_21705) | 1635156..1637690 | + | 2535 | WP_151607226.1 | HWE histidine kinase domain-containing protein | - |
NW321_RS21710 (NW321_21710) | 1637901..1638101 | + | 201 | WP_010660355.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NW321_RS21715 (NW321_21715) | 1638098..1638475 | + | 378 | WP_151576612.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NW321_RS21720 (NW321_21720) | 1638729..1639658 | - | 930 | WP_151576611.1 | LysR family transcriptional regulator | - |
NW321_RS21725 (NW321_21725) | 1639769..1640473 | + | 705 | WP_151607228.1 | HAD-IA family hydrolase | - |
NW321_RS21730 (NW321_21730) | 1640571..1641797 | + | 1227 | WP_226622752.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13988.20 Da Isoelectric Point: 7.0615
>T254971 WP_151576612.1 NZ_CP103346:1638098-1638475 [Brucella anthropi]
VILADTSIWIDHFRRGDNDLVKIIGNDLLLCHPAVIGELALGSLRDRTAVLTFLRAQRETIVATHDEVMTLIERHSVFSM
GIGYTDAHLLASVLLDQRTSLWTRDKRLKLAALKAGAALYEPFHN
VILADTSIWIDHFRRGDNDLVKIIGNDLLLCHPAVIGELALGSLRDRTAVLTFLRAQRETIVATHDEVMTLIERHSVFSM
GIGYTDAHLLASVLLDQRTSLWTRDKRLKLAALKAGAALYEPFHN
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|