Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 1604216..1604762 | Replicon | chromosome |
Accession | NZ_CP103346 | ||
Organism | Brucella anthropi strain CGMCC 1.17299 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | NW321_RS21500 | Protein ID | WP_151576736.1 |
Coordinates | 1604216..1604509 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A011V9B1 |
Locus tag | NW321_RS21505 | Protein ID | WP_036586943.1 |
Coordinates | 1604520..1604762 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW321_RS21485 (NW321_21485) | 1600133..1601647 | - | 1515 | WP_151607189.1 | sugar ABC transporter ATP-binding protein | - |
NW321_RS21490 (NW321_21490) | 1601740..1602693 | - | 954 | WP_151576658.1 | substrate-binding domain-containing protein | - |
NW321_RS21495 (NW321_21495) | 1603030..1604004 | + | 975 | WP_151576657.1 | sugar-binding domain-containing protein | - |
NW321_RS21500 (NW321_21500) | 1604216..1604509 | - | 294 | WP_151576736.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NW321_RS21505 (NW321_21505) | 1604520..1604762 | - | 243 | WP_036586943.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
NW321_RS21510 (NW321_21510) | 1605301..1605738 | - | 438 | WP_080692061.1 | IS5 family transposase | - |
NW321_RS21515 (NW321_21515) | 1605991..1606434 | + | 444 | WP_063620589.1 | universal stress protein | - |
NW321_RS21520 (NW321_21520) | 1606779..1607273 | + | 495 | Protein_1470 | divalent metal cation transporter | - |
NW321_RS21525 (NW321_21525) | 1607194..1607478 | + | 285 | WP_259030534.1 | divalent metal cation transporter | - |
NW321_RS21530 (NW321_21530) | 1607585..1609111 | + | 1527 | WP_151652607.1 | IS21 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11187.94 Da Isoelectric Point: 5.5510
>T254970 WP_151576736.1 NZ_CP103346:c1604509-1604216 [Brucella anthropi]
MEFKLSVLAEDDIIAIAEQGIAMFGPVQAKRYHAELFNTLDLIANNPQIARAREEISPPVRVHPFKAHLIIYQIETDGMV
FVIRVRHAFEDWVRDPF
MEFKLSVLAEDDIIAIAEQGIAMFGPVQAKRYHAELFNTLDLIANNPQIARAREEISPPVRVHPFKAHLIIYQIETDGMV
FVIRVRHAFEDWVRDPF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|