Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 671776..672473 | Replicon | chromosome |
| Accession | NZ_CP103345 | ||
| Organism | Brucella anthropi strain CGMCC 1.17299 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A6WWK8 |
| Locus tag | NW321_RS03140 | Protein ID | WP_012090892.1 |
| Coordinates | 672045..672473 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A256H0E6 |
| Locus tag | NW321_RS03135 | Protein ID | WP_012090891.1 |
| Coordinates | 671776..672048 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW321_RS03115 (NW321_03115) | 667466..668386 | + | 921 | WP_012090886.1 | glutathione ABC transporter permease GsiC | - |
| NW321_RS03120 (NW321_03120) | 668383..669267 | + | 885 | WP_012090887.1 | ABC transporter permease subunit | - |
| NW321_RS03125 (NW321_03125) | 669280..670098 | + | 819 | WP_012090888.1 | M55 family metallopeptidase | - |
| NW321_RS03130 (NW321_03130) | 670141..671076 | + | 936 | WP_012090889.1 | isoaspartyl peptidase/L-asparaginase | - |
| NW321_RS03135 (NW321_03135) | 671776..672048 | + | 273 | WP_012090891.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NW321_RS03140 (NW321_03140) | 672045..672473 | + | 429 | WP_012090892.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NW321_RS03145 (NW321_03145) | 672484..672792 | - | 309 | WP_012090893.1 | HigA family addiction module antitoxin | - |
| NW321_RS03150 (NW321_03150) | 673563..674870 | + | 1308 | WP_259030354.1 | IS1380 family transposase | - |
| NW321_RS03155 (NW321_03155) | 675065..676342 | - | 1278 | WP_012090895.1 | ABC transporter substrate-binding protein | - |
| NW321_RS03160 (NW321_03160) | 676384..677271 | - | 888 | WP_259030355.1 | carbohydrate ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 647369..729307 | 81938 | |
| - | flank | IS/Tn | - | - | 673563..674870 | 1307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15101.23 Da Isoelectric Point: 4.4540
>T254969 WP_012090892.1 NZ_CP103345:672045-672473 [Brucella anthropi]
MMIVDASAIIAILFDEVEAPECMDALQSDTARLISAVNYVEAGTVLAGRIREGDRHAAIADLDAFLADFGILVASIDDRL
ARAAMKARVEYGKGFGTRAGLNFGDCFAYALAKRHSAPLLYVGDDFALTDIQSALSRGPCQG
MMIVDASAIIAILFDEVEAPECMDALQSDTARLISAVNYVEAGTVLAGRIREGDRHAAIADLDAFLADFGILVASIDDRL
ARAAMKARVEYGKGFGTRAGLNFGDCFAYALAKRHSAPLLYVGDDFALTDIQSALSRGPCQG
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6WWK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A256H0E6 |