Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PanAT/DUF4065(antitoxin)
Location 4391064..4392108 Replicon chromosome
Accession NZ_CP103329
Organism Escherichia coli strain ZY22049

Toxin (Protein)


Gene name panT Uniprot ID A0A829CP20
Locus tag NX000_RS21590 Protein ID WP_000019186.1
Coordinates 4391064..4391612 (-) Length 183 a.a.

Antitoxin (Protein)


Gene name panA Uniprot ID A0A839B6W4
Locus tag NX000_RS21595 Protein ID WP_000287252.1
Coordinates 4391635..4392108 (-) Length 158 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NX000_RS21545 (4386227) 4386227..4387045 - 819 WP_021527492.1 helix-turn-helix domain-containing protein -
NX000_RS21550 (4387042) 4387042..4387278 - 237 WP_000933942.1 hypothetical protein -
NX000_RS21555 (4387271) 4387271..4387708 - 438 WP_229021219.1 ash family protein -
NX000_RS21560 (4387779) 4387779..4387958 - 180 WP_001341559.1 DUF4222 domain-containing protein -
NX000_RS21565 (4388104) 4388104..4388655 - 552 WP_000515860.1 protein YmfL -
NX000_RS21570 (4388717) 4388717..4388866 + 150 Protein_4222 protein YfdP -
NX000_RS21575 (4388932) 4388932..4389756 + 825 WP_001753751.1 DUF2303 family protein -
NX000_RS21580 (4389943) 4389943..4390725 + 783 WP_000610754.1 hypothetical protein -
NX000_RS21585 (4390762) 4390762..4391013 + 252 Protein_4225 pyocin activator PrtN family protein -
NX000_RS21590 (4391064) 4391064..4391612 - 549 WP_000019186.1 hypothetical protein Toxin
NX000_RS21595 (4391635) 4391635..4392108 - 474 WP_000287252.1 DUF4065 domain-containing protein Antitoxin
NX000_RS21600 (4392413) 4392413..4392517 - 105 Protein_4228 tRNA-dihydrouridine synthase -
NX000_RS21605 (4392880) 4392880..4393620 - 741 WP_001324389.1 DUF2713 family protein -
NX000_RS21610 (4393615) 4393615..4393896 - 282 Protein_4230 DUF2713 domain-containing protein -
NX000_RS21615 (4394214) 4394214..4394729 + 516 WP_001295691.1 zinc uptake transcriptional repressor Zur -
NX000_RS21620 (4394771) 4394771..4394980 - 210 WP_001030593.1 CsbD family protein -
NX000_RS21625 (4395096) 4395096..4396421 - 1326 WP_001301116.1 MATE family efflux transporter DinF -
NX000_RS21630 (4396494) 4396494..4397102 - 609 WP_000646078.1 transcriptional repressor LexA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4367556..4397102 29546


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Antitoxin SocA-like, Panacea domain

(27-123)


Sequences

Toxin        


Download         Length: 183 a.a.        Molecular weight: 20026.39 Da        Isoelectric Point: 4.4481

>T254947 WP_000019186.1 NZ_CP103329:c4391612-4391064 [Escherichia coli]
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKAPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK

Download         Length: 549 bp

Antitoxin


Download         Length: 158 a.a.        Molecular weight: 17298.80 Da        Isoelectric Point: 8.4143

>AT254947 WP_000287252.1 NZ_CP103329:c4392108-4391635 [Escherichia coli]
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL

Download         Length: 474 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CP20

Antitoxin

Source ID Structure
AlphaFold DB A0A839B6W4

References