Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1335858..1336483 | Replicon | chromosome |
Accession | NZ_CP103329 | ||
Organism | Escherichia coli strain ZY22049 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NX000_RS06520 | Protein ID | WP_000911330.1 |
Coordinates | 1336085..1336483 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NX000_RS06515 | Protein ID | WP_000450524.1 |
Coordinates | 1335858..1336085 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX000_RS06490 (1331661) | 1331661..1332131 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
NX000_RS06495 (1332131) | 1332131..1332703 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NX000_RS06500 (1332849) | 1332849..1333727 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NX000_RS06505 (1333744) | 1333744..1334778 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
NX000_RS06510 (1334991) | 1334991..1335704 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NX000_RS06515 (1335858) | 1335858..1336085 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NX000_RS06520 (1336085) | 1336085..1336483 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NX000_RS06525 (1336630) | 1336630..1337493 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
NX000_RS06530 (1337508) | 1337508..1339523 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NX000_RS06535 (1339597) | 1339597..1340295 | + | 699 | WP_000679823.1 | esterase | - |
NX000_RS06540 (1340405) | 1340405..1340605 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T254938 WP_000911330.1 NZ_CP103329:1336085-1336483 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|