Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 3750..4330 | Replicon | plasmid phvKP12-F |
Accession | NZ_CP103321 | ||
Organism | Klebsiella pneumoniae strain hvKP12 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | NXZ72_RS30360 | Protein ID | WP_071177730.1 |
Coordinates | 4016..4330 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | NXZ72_RS30355 | Protein ID | WP_000093040.1 |
Coordinates | 3750..4028 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NXZ72_RS30335 (NXZ72_30335) | 191..1678 | - | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
NXZ72_RS30340 (NXZ72_30340) | 2323..2568 | + | 246 | WP_032440458.1 | hypothetical protein | - |
NXZ72_RS30345 (NXZ72_30345) | 2842..3213 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
NXZ72_RS30350 (NXZ72_30350) | 3210..3575 | + | 366 | WP_072354022.1 | TonB family protein | - |
NXZ72_RS30355 (NXZ72_30355) | 3750..4028 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NXZ72_RS30360 (NXZ72_30360) | 4016..4330 | + | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NXZ72_RS30365 (NXZ72_30365) | 4494..4922 | + | 429 | WP_001140599.1 | hypothetical protein | - |
NXZ72_RS30370 (NXZ72_30370) | 4948..5127 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
NXZ72_RS30375 (NXZ72_30375) | 5154..5684 | - | 531 | WP_071177729.1 | hypothetical protein | - |
NXZ72_RS30380 (NXZ72_30380) | 5691..6422 | - | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
NXZ72_RS30385 (NXZ72_30385) | 6422..8386 | - | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..11970 | 11970 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T254930 WP_071177730.1 NZ_CP103321:4016-4330 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|