Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 37014..37657 | Replicon | plasmid phvKP12-KPC |
Accession | NZ_CP103319 | ||
Organism | Klebsiella pneumoniae strain hvKP12 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | NXZ72_RS29670 | Protein ID | WP_001044770.1 |
Coordinates | 37014..37430 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | NXZ72_RS29675 | Protein ID | WP_001261282.1 |
Coordinates | 37427..37657 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NXZ72_RS29650 (33117) | 33117..33389 | - | 273 | Protein_41 | transposase | - |
NXZ72_RS29660 (34371) | 34371..35393 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
NXZ72_RS29665 (35378) | 35378..36940 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
NXZ72_RS29670 (37014) | 37014..37430 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NXZ72_RS29675 (37427) | 37427..37657 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NXZ72_RS29680 (37614) | 37614..38075 | + | 462 | WP_014343465.1 | hypothetical protein | - |
NXZ72_RS29685 (38236) | 38236..39180 | + | 945 | WP_011977810.1 | hypothetical protein | - |
NXZ72_RS29690 (39217) | 39217..39609 | + | 393 | WP_011977811.1 | hypothetical protein | - |
NXZ72_RS29695 (39667) | 39667..40188 | + | 522 | WP_013214008.1 | hypothetical protein | - |
NXZ72_RS29700 (40234) | 40234..40437 | + | 204 | WP_011977813.1 | hypothetical protein | - |
NXZ72_RS29705 (40467) | 40467..41471 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
NXZ72_RS29710 (41655) | 41655..42434 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-65 / blaSHV-12 / blaKPC-2 | - | 1..83447 | 83447 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T254927 WP_001044770.1 NZ_CP103319:c37430-37014 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |