254924

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 23526..24196 Replicon plasmid phvKP12-VIR
Accession NZ_CP103316
Organism Klebsiella pneumoniae strain hvKP12

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NXZ72_RS27310 Protein ID WP_004213072.1
Coordinates 23753..24196 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NXZ72_RS27305 Protein ID WP_004213073.1
Coordinates 23526..23756 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NXZ72_RS27275 (NXZ72_27275) 18711..19490 - 780 WP_004213560.1 site-specific integrase -
NXZ72_RS27280 (NXZ72_27280) 19487..20308 - 822 WP_004213562.1 hypothetical protein -
NXZ72_RS27285 (NXZ72_27285) 20808..21071 - 264 Protein_23 hypothetical protein -
NXZ72_RS27290 (NXZ72_27290) 21280..21486 + 207 WP_004213077.1 hypothetical protein -
NXZ72_RS27295 (NXZ72_27295) 21476..21769 - 294 WP_004213076.1 hypothetical protein -
NXZ72_RS27300 (NXZ72_27300) 21785..22918 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
NXZ72_RS27305 (NXZ72_27305) 23526..23756 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NXZ72_RS27310 (NXZ72_27310) 23753..24196 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NXZ72_RS27315 (NXZ72_27315) 24345..24596 + 252 WP_186987481.1 hypothetical protein -
NXZ72_RS27320 (NXZ72_27320) 24619..24923 - 305 Protein_30 transposase -
NXZ72_RS27325 (NXZ72_27325) 25340..25975 + 636 Protein_31 mucoid phenotype regulator RmpA2 -
NXZ72_RS27330 (NXZ72_27330) 26493..26896 - 404 Protein_32 GAF domain-containing protein -
NXZ72_RS27335 (NXZ72_27335) 26987..27907 - 921 WP_004213934.1 DUF1471 domain-containing protein -
NXZ72_RS27340 (NXZ72_27340) 27956..28447 - 492 WP_011251327.1 DM13 domain-containing protein -
NXZ72_RS27345 (NXZ72_27345) 28510..28785 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / iroN / rmpA 1..225067 225067


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T254924 WP_004213072.1 NZ_CP103316:23753-24196 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT254924 WP_004213073.1 NZ_CP103316:23526-23756 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References