Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4213251..4213870 | Replicon | chromosome |
| Accession | NZ_CP103315 | ||
| Organism | Klebsiella pneumoniae strain hvKP12 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NXZ72_RS21035 | Protein ID | WP_002892050.1 |
| Coordinates | 4213652..4213870 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NXZ72_RS21030 | Protein ID | WP_002892066.1 |
| Coordinates | 4213251..4213625 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NXZ72_RS21020 (NXZ72_21020) | 4208403..4209596 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NXZ72_RS21025 (NXZ72_21025) | 4209619..4212765 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NXZ72_RS21030 (NXZ72_21030) | 4213251..4213625 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NXZ72_RS21035 (NXZ72_21035) | 4213652..4213870 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NXZ72_RS21040 (NXZ72_21040) | 4214029..4214595 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NXZ72_RS21045 (NXZ72_21045) | 4214567..4214707 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NXZ72_RS21050 (NXZ72_21050) | 4214728..4215198 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| NXZ72_RS21055 (NXZ72_21055) | 4215173..4216624 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| NXZ72_RS21060 (NXZ72_21060) | 4216725..4217423 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| NXZ72_RS21065 (NXZ72_21065) | 4217420..4217560 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NXZ72_RS21070 (NXZ72_21070) | 4217560..4217823 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T254919 WP_002892050.1 NZ_CP103315:4213652-4213870 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT254919 WP_002892066.1 NZ_CP103315:4213251-4213625 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |