Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4213251..4213870 Replicon chromosome
Accession NZ_CP103315
Organism Klebsiella pneumoniae strain hvKP12

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NXZ72_RS21035 Protein ID WP_002892050.1
Coordinates 4213652..4213870 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NXZ72_RS21030 Protein ID WP_002892066.1
Coordinates 4213251..4213625 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NXZ72_RS21020 (NXZ72_21020) 4208403..4209596 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NXZ72_RS21025 (NXZ72_21025) 4209619..4212765 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NXZ72_RS21030 (NXZ72_21030) 4213251..4213625 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NXZ72_RS21035 (NXZ72_21035) 4213652..4213870 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NXZ72_RS21040 (NXZ72_21040) 4214029..4214595 + 567 WP_002892030.1 maltose O-acetyltransferase -
NXZ72_RS21045 (NXZ72_21045) 4214567..4214707 - 141 WP_004147370.1 hypothetical protein -
NXZ72_RS21050 (NXZ72_21050) 4214728..4215198 + 471 WP_002892026.1 YlaC family protein -
NXZ72_RS21055 (NXZ72_21055) 4215173..4216624 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NXZ72_RS21060 (NXZ72_21060) 4216725..4217423 + 699 WP_002892021.1 GNAT family protein -
NXZ72_RS21065 (NXZ72_21065) 4217420..4217560 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NXZ72_RS21070 (NXZ72_21070) 4217560..4217823 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254919 WP_002892050.1 NZ_CP103315:4213652-4213870 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254919 WP_002892066.1 NZ_CP103315:4213251-4213625 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References