Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 2253343..2253902 | Replicon | chromosome |
Accession | NZ_CP103308 | ||
Organism | Rhodococcus pyridinivorans strain RL-GZ01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NXT08_RS10445 | Protein ID | WP_024102981.1 |
Coordinates | 2253343..2253621 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NXT08_RS10450 | Protein ID | WP_024102980.1 |
Coordinates | 2253618..2253902 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NXT08_RS10415 (NXT08_10415) | 2248464..2249183 | + | 720 | WP_258913842.1 | 2OG-Fe(II) oxygenase | - |
NXT08_RS10420 (NXT08_10420) | 2249220..2250191 | - | 972 | WP_006551850.1 | phosphotriesterase | - |
NXT08_RS10425 (NXT08_10425) | 2250236..2251066 | - | 831 | WP_024102985.1 | SDR family oxidoreductase | - |
NXT08_RS10430 (NXT08_10430) | 2251187..2251849 | + | 663 | WP_024102984.1 | alpha-ketoglutarate-dependent dioxygenase AlkB | - |
NXT08_RS10435 (NXT08_10435) | 2251999..2252748 | + | 750 | WP_024102983.1 | cutinase family protein | - |
NXT08_RS10440 (NXT08_10440) | 2252807..2253286 | + | 480 | WP_024102982.1 | MarR family transcriptional regulator | - |
NXT08_RS10445 (NXT08_10445) | 2253343..2253621 | - | 279 | WP_024102981.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NXT08_RS10450 (NXT08_10450) | 2253618..2253902 | - | 285 | WP_024102980.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NXT08_RS10455 (NXT08_10455) | 2254122..2254940 | - | 819 | WP_006551857.1 | family 1 encapsulin nanocompartment shell protein | - |
NXT08_RS10460 (NXT08_10460) | 2254937..2255965 | - | 1029 | WP_024102977.1 | Dyp-type peroxidase | - |
NXT08_RS10465 (NXT08_10465) | 2256042..2257643 | - | 1602 | WP_252173680.1 | L-lactate permease | - |
NXT08_RS10470 (NXT08_10470) | 2257648..2258076 | - | 429 | WP_258913843.1 | HIT family protein | - |
NXT08_RS10475 (NXT08_10475) | 2258073..2258699 | - | 627 | WP_231911981.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10268.82 Da Isoelectric Point: 10.2002
>T254908 WP_024102981.1 NZ_CP103308:c2253621-2253343 [Rhodococcus pyridinivorans]
MSTPDHPYRLVMARSAARAMARSLPEKVATAVYEFVTGPLLENPKRVGKPLNPPLAPAYSARRGEYRVLYLIDDANRTVE
VTAISHRADAYR
MSTPDHPYRLVMARSAARAMARSLPEKVATAVYEFVTGPLLENPKRVGKPLNPPLAPAYSARRGEYRVLYLIDDANRTVE
VTAISHRADAYR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|