Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 5989000..5989760 | Replicon | chromosome |
Accession | NZ_CP103300 | ||
Organism | Endozoicomonas euniceicola strain EF212 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | NX720_RS24345 | Protein ID | WP_262598148.1 |
Coordinates | 5989000..5989506 (-) | Length | 169 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | NX720_RS24350 | Protein ID | WP_262598150.1 |
Coordinates | 5989497..5989760 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX720_RS24335 (NX720_24335) | 5984286..5986190 | + | 1905 | WP_262598144.1 | TrbC family F-type conjugative pilus assembly protein | - |
NX720_RS24340 (NX720_24340) | 5986163..5989009 | + | 2847 | WP_262598145.1 | conjugal transfer protein TraN | - |
NX720_RS24345 (NX720_24345) | 5989000..5989506 | - | 507 | WP_262598148.1 | GNAT family N-acetyltransferase | Toxin |
NX720_RS24350 (NX720_24350) | 5989497..5989760 | - | 264 | WP_262598150.1 | DUF1778 domain-containing protein | Antitoxin |
NX720_RS24355 (NX720_24355) | 5989839..5990120 | + | 282 | WP_262598152.1 | type IV conjugative transfer system protein TraL | - |
NX720_RS24360 (NX720_24360) | 5990117..5990671 | + | 555 | WP_262598155.1 | type IV conjugative transfer system protein TraE | - |
NX720_RS24365 (NX720_24365) | 5990692..5990841 | + | 150 | WP_262598156.1 | hypothetical protein | - |
NX720_RS24370 (NX720_24370) | 5990918..5991538 | + | 621 | WP_262598158.1 | hypothetical protein | - |
NX720_RS24375 (NX720_24375) | 5991535..5991663 | + | 129 | WP_262598159.1 | hypothetical protein | - |
NX720_RS24380 (NX720_24380) | 5992050..5992835 | + | 786 | WP_262598161.1 | type-F conjugative transfer system secretin TraK | - |
NX720_RS24385 (NX720_24385) | 5992858..5994033 | + | 1176 | WP_262598162.1 | TraB/VirB10 family protein | - |
NX720_RS24390 (NX720_24390) | 5994030..5994473 | + | 444 | WP_262598164.1 | TraV family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5967195..6000983 | 33788 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 18636.61 Da Isoelectric Point: 8.5010
>T254900 WP_262598148.1 NZ_CP103300:c5989506-5989000 [Endozoicomonas euniceicola]
VGVIRAPELLTKDHNTDDFDCGHDVLTEWLKKTALKNQSANASRTFVVCKGDRVVGYYALSSGSIERMQTPKSLARNMPD
PIPVTVLGRLAIDQEHQGMRIGSGLLKDAMMRTLVVSQHIGVKAMLVHAVSEEARQFYLQYGFKESPFNPMTLMLPVKHI
VGLFPDQG
VGVIRAPELLTKDHNTDDFDCGHDVLTEWLKKTALKNQSANASRTFVVCKGDRVVGYYALSSGSIERMQTPKSLARNMPD
PIPVTVLGRLAIDQEHQGMRIGSGLLKDAMMRTLVVSQHIGVKAMLVHAVSEEARQFYLQYGFKESPFNPMTLMLPVKHI
VGLFPDQG
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|