Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5168542..5169133 | Replicon | chromosome |
Accession | NZ_CP103300 | ||
Organism | Endozoicomonas euniceicola strain EF212 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NX720_RS20950 | Protein ID | WP_262597236.1 |
Coordinates | 5168542..5168847 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NX720_RS20955 | Protein ID | WP_262597237.1 |
Coordinates | 5168840..5169133 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX720_RS20920 (NX720_20920) | 5164656..5165087 | + | 432 | Protein_4081 | transposase | - |
NX720_RS20925 (NX720_20925) | 5165272..5166108 | + | 837 | WP_262597230.1 | transposase | - |
NX720_RS20930 (NX720_20930) | 5166146..5167639 | + | 1494 | WP_262596131.1 | ISKra4 family transposase | - |
NX720_RS20935 (NX720_20935) | 5167650..5167850 | + | 201 | Protein_4084 | hypothetical protein | - |
NX720_RS20940 (NX720_20940) | 5167861..5168061 | + | 201 | WP_262597232.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NX720_RS20945 (NX720_20945) | 5168039..5168338 | + | 300 | WP_262597234.1 | helix-turn-helix transcriptional regulator | - |
NX720_RS20950 (NX720_20950) | 5168542..5168847 | + | 306 | WP_262597236.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NX720_RS20955 (NX720_20955) | 5168840..5169133 | + | 294 | WP_262597237.1 | putative addiction module antidote protein | Antitoxin |
NX720_RS20960 (NX720_20960) | 5169375..5169626 | - | 252 | WP_262597238.1 | hypothetical protein | - |
NX720_RS20965 (NX720_20965) | 5169728..5170639 | - | 912 | WP_262597240.1 | hypothetical protein | - |
NX720_RS20970 (NX720_20970) | 5170894..5172603 | + | 1710 | WP_262597242.1 | hypothetical protein | - |
NX720_RS20975 (NX720_20975) | 5172603..5173307 | + | 705 | WP_262597244.1 | OmpA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 5160894..5170639 | 9745 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11776.80 Da Isoelectric Point: 10.5545
>T254898 WP_262597236.1 NZ_CP103300:5168542-5168847 [Endozoicomonas euniceicola]
MITIKQHDTFRQWLKAVKDPKAKSLILSRIKRMAFGLFGDVKPVGGGFSELRIDTGKGYRVYFMRQGDELIILLCGSQKK
NQQKQIELAKTLYKEWRNENE
MITIKQHDTFRQWLKAVKDPKAKSLILSRIKRMAFGLFGDVKPVGGGFSELRIDTGKGYRVYFMRQGDELIILLCGSQKK
NQQKQIELAKTLYKEWRNENE
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|