Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YefM-YoeB |
Location | 3609707..3610269 | Replicon | chromosome |
Accession | NZ_CP103300 | ||
Organism | Endozoicomonas euniceicola strain EF212 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NX720_RS14690 | Protein ID | WP_262595556.1 |
Coordinates | 3609707..3610018 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NX720_RS14695 | Protein ID | WP_262595557.1 |
Coordinates | 3610015..3610269 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX720_RS14670 (NX720_14670) | 3604979..3606514 | - | 1536 | WP_262595552.1 | alanine/glycine:cation symporter family protein | - |
NX720_RS14675 (NX720_14675) | 3606863..3608296 | + | 1434 | WP_262595553.1 | carbon starvation protein A | - |
NX720_RS14680 (NX720_14680) | 3608423..3609328 | + | 906 | WP_262595554.1 | methyltransferase domain-containing protein | - |
NX720_RS14685 (NX720_14685) | 3609478..3609621 | - | 144 | WP_262595555.1 | hypothetical protein | - |
NX720_RS14690 (NX720_14690) | 3609707..3610018 | + | 312 | WP_262595556.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Toxin |
NX720_RS14695 (NX720_14695) | 3610015..3610269 | + | 255 | WP_262595557.1 | Txe/YoeB family addiction module toxin | Antitoxin |
NX720_RS14705 (NX720_14705) | 3610767..3611534 | - | 768 | WP_262595558.1 | type II secretion system protein N | - |
NX720_RS14710 (NX720_14710) | 3611531..3612052 | - | 522 | WP_262595559.1 | type II secretion system protein M | - |
NX720_RS14715 (NX720_14715) | 3612049..3613281 | - | 1233 | WP_262595560.1 | type II secretion system protein GspL | - |
NX720_RS14720 (NX720_14720) | 3613278..3614261 | - | 984 | WP_262595561.1 | type II secretion system minor pseudopilin GspK | - |
NX720_RS14725 (NX720_14725) | 3614261..3614884 | - | 624 | WP_262595562.1 | type II secretion system minor pseudopilin GspJ | - |
NX720_RS14730 (NX720_14730) | 3614893..3615258 | - | 366 | WP_262595563.1 | type II secretion system minor pseudopilin GspI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11785.38 Da Isoelectric Point: 6.9776
>T254895 WP_262595556.1 NZ_CP103300:3609707-3610018 [Endozoicomonas euniceicola]
MQLKKRVRLTCAHNMEIHLMDVMTYSDFRSNLARTIDRVNDNHKPVLVTRQNGKPAVLMSVEDYNAFQETAYLMASPKNA
QRLSEAIHQIESGQSTDHGLIDE
MQLKKRVRLTCAHNMEIHLMDVMTYSDFRSNLARTIDRVNDNHKPVLVTRQNGKPAVLMSVEDYNAFQETAYLMASPKNA
QRLSEAIHQIESGQSTDHGLIDE
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|