Detailed information of TA system TA254893

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): mazEF/PemK-MazE
• Location: 2989646..2990193
• Replicon: chromosome
• Accession: NZ_CP103300
• Organism: Endozoicomonas euniceicola strain EF212

Toxin (Protein)

• Gene name: mazF
• Uniprot ID: -
• Locus tag: NX720_RS11695
• Protein ID: WP_262601288.1
• Coordinates: 2989646..2989969 (-)
• Length: 108 a.a.

Antitoxin (Protein)

• Gene name: mazE
• Uniprot ID: -
• Locus tag: NX720_RS11700
• Protein ID: WP_262601289.1
• Coordinates: 2989966..2990193 (-)
• Length: 76 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NX720_RS11650 (NX720_11650)	2985094..2985228	+	135	WP_262601279.1	hypothetical protein	-
NX720_RS11655 (NX720_11655)	2985396..2985656	+	261	WP_262601280.1	hypothetical protein	-
NX720_RS11660 (NX720_11660)	2986020..2986586	-	567	WP_262601281.1	Uma2 family endonuclease	-
NX720_RS11665 (NX720_11665)	2987308..2987568	+	261	WP_262601282.1	hypothetical protein	-
NX720_RS11670 (NX720_11670)	2987637..2987837	+	201	WP_262601283.1	hypothetical protein	-
NX720_RS11675 (NX720_11675)	2987803..2988177	+	375	WP_262601284.1	transcriptional regulator	-
NX720_RS11680 (NX720_11680)	2988224..2988460	+	237	WP_262601285.1	BrnA antitoxin family protein	-
NX720_RS11685 (NX720_11685)	2988721..2988987	+	267	WP_262601286.1	DUF4160 domain-containing protein	-
NX720_RS11690 (NX720_11690)	2988980..2989246	+	267	WP_262601287.1	DUF2442 domain-containing protein	-
NX720_RS11695 (NX720_11695)	2989646..2989969	-	324	WP_262601288.1	type II toxin-antitoxin system PemK/MazF family toxin	Toxin
NX720_RS11700 (NX720_11700)	2989966..2990193	-	228	WP_262601289.1	antitoxin MazE family protein	Antitoxin
NX720_RS11705 (NX720_11705)	2990354..2990635	-	282	WP_262601290.1	CopG family antitoxin	-
NX720_RS11710 (NX720_11710)	2990632..2990910	-	279	WP_262601291.1	BrnT family toxin	-
NX720_RS11715 (NX720_11715)	2991325..2991624	-	300	WP_262601292.1	DUF5615 family PIN-like protein	-
NX720_RS11720 (NX720_11720)	2991624..2991845	-	222	WP_262601293.1	DUF433 domain-containing protein	-
NX720_RS11725 (NX720_11725)	2992231..2992446	-	216	WP_262601294.1	type II toxin-antitoxin system PemK/MazF family toxin	-
NX720_RS11730 (NX720_11730)	2992443..2992670	-	228	WP_262601295.1	antitoxin MazE family protein	-
NX720_RS11735 (NX720_11735)	2992857..2993111	-	255	WP_262601296.1	type II toxin-antitoxin system prevent-host-death family antitoxin	-
NX720_RS11740 (NX720_11740)	2993247..2994128	+	882	WP_262601297.1	UTP--glucose-1-phosphate uridylyltransferase GalU	-
NX720_RS11745 (NX720_11745)	2994224..2994652	-	429	WP_262595354.1	IS200/IS605 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	flank	IS/Tn	-	-	2994224..2994652	428

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• mRNA interferase PemK-like (1-105)

Antitoxin

• Antitoxin MazE-like (11-74)

Sequences

Toxin

Protein

• Length: 108 a.a.
• Molecular weight: 12014.97 Da
• Isoelectric Point: 9.5902

>T254893 WP_262601288.1 NZ_CP103300:c2989969-2989646 [Endozoicomonas euniceicola]
MRRGDIVTVAIKGDYGKPRPALVIQSDLFEQHPSVTILPITGEIRDTPLFRYNVYQDNDNGLTRPSQIMIDKITTIKIDK
VGNPIGQLSPRQMTEITRLVALWLGIA

Nucleotide

• Length: 324 bp

Antitoxin

Protein

• Length: 76 a.a.
• Molecular weight: 8885.72 Da
• Isoelectric Point: 5.1462

>AT254893 WP_262601289.1 NZ_CP103300:c2990193-2989966 [Endozoicomonas euniceicola]
MPNEHHSESARQRVKRHRDALREAGFRPVQIWVPDTRQEGFAEECRKQSASLKNDPEEMDTLNWIEHLSDDEGWT

Nucleotide

• Length: 228 bp