Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | VII | Classification (family/domain) | HepT-MntA/HepT(toxin) |
Location | 2955844..2956654 | Replicon | chromosome |
Accession | NZ_CP103300 | ||
Organism | Endozoicomonas euniceicola strain EF212 |
Toxin (Protein)
Gene name | hepT | Uniprot ID | - |
Locus tag | NX720_RS11520 | Protein ID | WP_262601254.1 |
Coordinates | 2956244..2956654 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | mntA | Uniprot ID | - |
Locus tag | NX720_RS11515 | Protein ID | WP_262601253.1 |
Coordinates | 2955844..2956251 (+) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX720_RS11485 (NX720_11485) | 2951264..2951542 | + | 279 | WP_262601247.1 | helix-turn-helix transcriptional regulator | - |
NX720_RS11490 (NX720_11490) | 2951539..2952816 | + | 1278 | WP_262601248.1 | type II toxin-antitoxin system HipA family toxin | - |
NX720_RS11495 (NX720_11495) | 2952979..2953290 | + | 312 | WP_262601249.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
NX720_RS11500 (NX720_11500) | 2953597..2953839 | + | 243 | WP_262601250.1 | helix-turn-helix transcriptional regulator | - |
NX720_RS11505 (NX720_11505) | 2953836..2955077 | + | 1242 | WP_262601251.1 | type II toxin-antitoxin system HipA family toxin | - |
NX720_RS11510 (NX720_11510) | 2955128..2955700 | - | 573 | WP_262601252.1 | hypothetical protein | - |
NX720_RS11515 (NX720_11515) | 2955844..2956251 | + | 408 | WP_262601253.1 | nucleotidyltransferase domain-containing protein | Antitoxin |
NX720_RS11520 (NX720_11520) | 2956244..2956654 | + | 411 | WP_262601254.1 | DUF86 domain-containing protein | Toxin |
NX720_RS11525 (NX720_11525) | 2956896..2957183 | + | 288 | WP_262601255.1 | putative addiction module antidote protein | - |
NX720_RS11530 (NX720_11530) | 2957384..2957626 | + | 243 | WP_262601256.1 | helix-turn-helix transcriptional regulator | - |
NX720_RS11535 (NX720_11535) | 2957623..2958864 | + | 1242 | WP_262601257.1 | type II toxin-antitoxin system HipA family toxin | - |
NX720_RS11540 (NX720_11540) | 2959014..2959262 | + | 249 | WP_262601258.1 | hypothetical protein | - |
NX720_RS11545 (NX720_11545) | 2959857..2960939 | + | 1083 | WP_262601259.1 | Fic family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15774.18 Da Isoelectric Point: 6.0900
>T254892 WP_262601254.1 NZ_CP103300:2956244-2956654 [Endozoicomonas euniceicola]
MDDVILNKYAIIQRCLMRIREEYVGHENELTTNFTRQDSIILNIQRASQAALDLSNRIIRLKQLPVPQESRESFSILSDH
SLVSTTLTDSMMKMVGFRNIAVHEYQKLNLDILKAVIEQHVQDIERFAVEVMKSVD
MDDVILNKYAIIQRCLMRIREEYVGHENELTTNFTRQDSIILNIQRASQAALDLSNRIIRLKQLPVPQESRESFSILSDH
SLVSTTLTDSMMKMVGFRNIAVHEYQKLNLDILKAVIEQHVQDIERFAVEVMKSVD
Download Length: 411 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15439.67 Da Isoelectric Point: 6.7050
>AT254892 WP_262601253.1 NZ_CP103300:2955844-2956251 [Endozoicomonas euniceicola]
MLPKTTCSHIIQYLKSEFKESLQGIVLYGSQAAGKATERSDIDLAVLLNRNISQYPLWNTAQTLACQLKKDVDLISLRKA
TTVLQKEVVEHGNWLLKSDEFACNLFETHVFSQYQQLQEDRREIIDDLIGRIKNG
MLPKTTCSHIIQYLKSEFKESLQGIVLYGSQAAGKATERSDIDLAVLLNRNISQYPLWNTAQTLACQLKKDVDLISLRKA
TTVLQKEVVEHGNWLLKSDEFACNLFETHVFSQYQQLQEDRREIIDDLIGRIKNG
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|