Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2279553..2280199 | Replicon | chromosome |
Accession | NZ_CP103300 | ||
Organism | Endozoicomonas euniceicola strain EF212 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NX720_RS08690 | Protein ID | WP_262601556.1 |
Coordinates | 2279792..2280199 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NX720_RS08685 | Protein ID | WP_262600739.1 |
Coordinates | 2279553..2279792 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX720_RS08665 (NX720_08665) | 2275449..2276474 | + | 1026 | WP_262600736.1 | UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase | - |
NX720_RS08670 (NX720_08670) | 2276547..2277032 | + | 486 | WP_262600737.1 | hypothetical protein | - |
NX720_RS08675 (NX720_08675) | 2277118..2278239 | + | 1122 | WP_262601555.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
NX720_RS08680 (NX720_08680) | 2278465..2279385 | - | 921 | WP_262600738.1 | metallophosphoesterase | - |
NX720_RS08685 (NX720_08685) | 2279553..2279792 | + | 240 | WP_262600739.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NX720_RS08690 (NX720_08690) | 2279792..2280199 | + | 408 | WP_262601556.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NX720_RS08695 (NX720_08695) | 2280225..2281871 | - | 1647 | WP_262600740.1 | dihydrolipoyllysine-residue acetyltransferase | - |
NX720_RS08700 (NX720_08700) | 2281931..2284588 | - | 2658 | WP_262600741.1 | pyruvate dehydrogenase (acetyl-transferring), homodimeric type | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15146.10 Da Isoelectric Point: 6.3329
>T254891 WP_262601556.1 NZ_CP103300:2279792-2280199 [Endozoicomonas euniceicola]
ILKFMLDTDISIFVLRHRSPELLGVFNAYDGQIAISSITLSELLHGVEKSSDPKQNRNTVESFVSRLEVLDYTSKASAHY
GDIRANLERRGQIIGVNDIHIAAHARSEGLIAVTNNVREFSRVDGLRVENWLEQA
ILKFMLDTDISIFVLRHRSPELLGVFNAYDGQIAISSITLSELLHGVEKSSDPKQNRNTVESFVSRLEVLDYTSKASAHY
GDIRANLERRGQIIGVNDIHIAAHARSEGLIAVTNNVREFSRVDGLRVENWLEQA
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|