Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/couple_hipB(antitoxin) |
Location | 1588417..1589006 | Replicon | chromosome |
Accession | NZ_CP103300 | ||
Organism | Endozoicomonas euniceicola strain EF212 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | NX720_RS06155 | Protein ID | WP_262600101.1 |
Coordinates | 1588417..1588581 (+) | Length | 55 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | - |
Locus tag | NX720_RS06160 | Protein ID | WP_262600103.1 |
Coordinates | 1588578..1589006 (+) | Length | 143 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX720_RS06125 (NX720_06125) | 1584536..1584805 | + | 270 | WP_262600096.1 | hypothetical protein | - |
NX720_RS06130 (NX720_06130) | 1584771..1585082 | + | 312 | WP_262601537.1 | HipA domain-containing protein | - |
NX720_RS06135 (NX720_06135) | 1585057..1585302 | - | 246 | Protein_1203 | IS200/IS605 family transposase | - |
NX720_RS06140 (NX720_06140) | 1585455..1586882 | + | 1428 | WP_262600098.1 | hypothetical protein | - |
NX720_RS06145 (NX720_06145) | 1586909..1587103 | - | 195 | Protein_1205 | transposase | - |
NX720_RS06150 (NX720_06150) | 1587169..1588341 | + | 1173 | WP_262600099.1 | transposase | - |
NX720_RS06155 (NX720_06155) | 1588417..1588581 | + | 165 | WP_262600101.1 | hypothetical protein | Toxin |
NX720_RS06160 (NX720_06160) | 1588578..1589006 | + | 429 | WP_262600103.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NX720_RS06165 (NX720_06165) | 1589040..1589750 | - | 711 | WP_262600105.1 | DUF3581 domain-containing protein | - |
NX720_RS06170 (NX720_06170) | 1590068..1591000 | + | 933 | WP_262600107.1 | hypothetical protein | - |
NX720_RS06175 (NX720_06175) | 1591149..1592087 | + | 939 | WP_262600109.1 | hypothetical protein | - |
NX720_RS06180 (NX720_06180) | 1592095..1593120 | - | 1026 | WP_262600110.1 | lipoyl synthase | - |
NX720_RS06185 (NX720_06185) | 1593154..1593840 | - | 687 | WP_262600112.1 | lipoyl(octanoyl) transferase LipB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 55 a.a. Molecular weight: 5947.91 Da Isoelectric Point: 4.4911
>T254890 WP_262600101.1 NZ_CP103300:1588417-1588581 [Endozoicomonas euniceicola]
VTADSVIEELSRLATQLVDLKPRLADQGVPESIVNLPAIGFGFLNDKLKKWDLI
VTADSVIEELSRLATQLVDLKPRLADQGVPESIVNLPAIGFGFLNDKLKKWDLI
Download Length: 165 bp
Antitoxin
Download Length: 143 a.a. Molecular weight: 15507.80 Da Isoelectric Point: 10.9924
>AT254890 WP_262600103.1 NZ_CP103300:1588578-1589006 [Endozoicomonas euniceicola]
MNTKMTSNARDRLARLRAQKSQQQLQKTAGNTSVSKPGSAPGSREAMILELMVQVLKGDITDGQLLQQLRKQLLGLNQDR
FAELVGVSRKTVSDIERGKGSPSQQVLNDVFKPFGLRAGIIPVSQSQTEKLINKAHDELLGG
MNTKMTSNARDRLARLRAQKSQQQLQKTAGNTSVSKPGSAPGSREAMILELMVQVLKGDITDGQLLQQLRKQLLGLNQDR
FAELVGVSRKTVSDIERGKGSPSQQVLNDVFKPFGLRAGIIPVSQSQTEKLINKAHDELLGG
Download Length: 429 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|