Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
Location | 1390856..1391655 | Replicon | chromosome |
Accession | NZ_CP103300 | ||
Organism | Endozoicomonas euniceicola strain EF212 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NX720_RS05410 | Protein ID | WP_262568568.1 |
Coordinates | 1391122..1391655 (+) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NX720_RS05405 | Protein ID | WP_262599912.1 |
Coordinates | 1390856..1391125 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX720_RS05380 (NX720_05380) | 1386150..1386920 | + | 771 | WP_262599905.1 | hypothetical protein | - |
NX720_RS05385 (NX720_05385) | 1387012..1387347 | - | 336 | WP_262599907.1 | group II intron maturase-specific domain-containing protein | - |
NX720_RS05390 (NX720_05390) | 1387466..1388713 | - | 1248 | WP_262599908.1 | group II intron reverse transcriptase/maturase | - |
NX720_RS05395 (NX720_05395) | 1388820..1388948 | - | 129 | WP_262599910.1 | hypothetical protein | - |
NX720_RS05400 (NX720_05400) | 1389244..1389954 | - | 711 | WP_262599911.1 | group II intron reverse transcriptase/maturase | - |
NX720_RS05405 (NX720_05405) | 1390856..1391125 | + | 270 | WP_262599912.1 | DUF1778 domain-containing protein | Antitoxin |
NX720_RS05410 (NX720_05410) | 1391122..1391655 | + | 534 | WP_262568568.1 | GNAT family N-acetyltransferase | Toxin |
NX720_RS05415 (NX720_05415) | 1392090..1392359 | - | 270 | Protein_1059 | transposase | - |
NX720_RS05420 (NX720_05420) | 1392847..1394259 | - | 1413 | WP_262599914.1 | transposase | - |
NX720_RS05425 (NX720_05425) | 1394402..1395568 | + | 1167 | WP_262599916.1 | ISAs1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19927.37 Da Isoelectric Point: 8.4877
>T254889 WP_262568568.1 NZ_CP103300:1391122-1391655 [Endozoicomonas euniceicola]
VSWSKEFVELDKGIHDRASFDCGEAELNLFIQTQAAKHMQAGISRTMVLPASSPLPNQKIPVCAFYSIVPSSICRDTLPK
ALAKKLPRYPIPVFLIAQLAVHREFHGEGLGKICLINALKYLWEINSHMRAYAIIVDCLTDSAERFYAKYGFEVLCEHNG
RVRMFLPMKTVAQLFGP
VSWSKEFVELDKGIHDRASFDCGEAELNLFIQTQAAKHMQAGISRTMVLPASSPLPNQKIPVCAFYSIVPSSICRDTLPK
ALAKKLPRYPIPVFLIAQLAVHREFHGEGLGKICLINALKYLWEINSHMRAYAIIVDCLTDSAERFYAKYGFEVLCEHNG
RVRMFLPMKTVAQLFGP
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|