Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pmenTA/darT(toxin) |
Location | 1027159..1028873 | Replicon | chromosome |
Accession | NZ_CP103300 | ||
Organism | Endozoicomonas euniceicola strain EF212 |
Toxin (Protein)
Gene name | pmenT | Uniprot ID | - |
Locus tag | NX720_RS03975 | Protein ID | WP_262599549.1 |
Coordinates | 1028229..1028873 (-) | Length | 215 a.a. |
Antitoxin (Protein)
Gene name | pmenA | Uniprot ID | - |
Locus tag | NX720_RS03970 | Protein ID | WP_262599547.1 |
Coordinates | 1027159..1028232 (-) | Length | 358 a.a. |
Genomic Context
Location: 1022554..1022731 (178 bp)
Type: Others
Protein ID: Protein_767
Type: Others
Protein ID: Protein_767
Location: 1024156..1024581 (426 bp)
Type: Others
Protein ID: Protein_769
Type: Others
Protein ID: Protein_769
Location: 1024564..1025121 (558 bp)
Type: Others
Protein ID: Protein_770
Type: Others
Protein ID: Protein_770
Location: 1025146..1025769 (624 bp)
Type: Others
Protein ID: Protein_771
Type: Others
Protein ID: Protein_771
Location: 1025797..1026372 (576 bp)
Type: Others
Protein ID: Protein_772
Type: Others
Protein ID: Protein_772
Location: 1026703..1027023 (321 bp)
Type: Others
Protein ID: WP_262599545.1
Type: Others
Protein ID: WP_262599545.1
Location: 1023181..1023531 (351 bp)
Type: Others
Protein ID: WP_262599543.1
Type: Others
Protein ID: WP_262599543.1
Location: 1027159..1028232 (1074 bp)
Type: Antitoxin
Protein ID: WP_262599547.1
Type: Antitoxin
Protein ID: WP_262599547.1
Location: 1028229..1028873 (645 bp)
Type: Toxin
Protein ID: WP_262599549.1
Type: Toxin
Protein ID: WP_262599549.1
Location: 1028873..1029097 (225 bp)
Type: Others
Protein ID: WP_262599550.1
Type: Others
Protein ID: WP_262599550.1
Location: 1029094..1030383 (1290 bp)
Type: Others
Protein ID: WP_262599551.1
Type: Others
Protein ID: WP_262599551.1
Location: 1030376..1033081 (2706 bp)
Type: Others
Protein ID: WP_262599552.1
Type: Others
Protein ID: WP_262599552.1
Location: 1033274..1033678 (405 bp)
Type: Others
Protein ID: WP_262599553.1
Type: Others
Protein ID: WP_262599553.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX720_RS03935 (NX720_03935) | 1022554..1022731 | + | 178 | Protein_767 | IS1 family transposase | - |
NX720_RS03940 (NX720_03940) | 1023181..1023531 | - | 351 | WP_262599543.1 | DUF805 domain-containing protein | - |
NX720_RS03945 (NX720_03945) | 1024156..1024581 | + | 426 | Protein_769 | sel1 repeat family protein | - |
NX720_RS03950 (NX720_03950) | 1024564..1025121 | + | 558 | Protein_770 | sel1 repeat family protein | - |
NX720_RS03955 (NX720_03955) | 1025146..1025769 | + | 624 | Protein_771 | sel1 repeat family protein | - |
NX720_RS03960 (NX720_03960) | 1025797..1026372 | + | 576 | Protein_772 | sel1 repeat family protein | - |
NX720_RS03965 (NX720_03965) | 1026703..1027023 | + | 321 | WP_262599545.1 | Rap1a/Tai family immunity protein | - |
NX720_RS03970 (NX720_03970) | 1027159..1028232 | - | 1074 | WP_262599547.1 | macro domain-containing protein | Antitoxin |
NX720_RS03975 (NX720_03975) | 1028229..1028873 | - | 645 | WP_262599549.1 | DUF4433 domain-containing protein | Toxin |
NX720_RS03980 (NX720_03980) | 1028873..1029097 | - | 225 | WP_262599550.1 | hypothetical protein | - |
NX720_RS03985 (NX720_03985) | 1029094..1030383 | - | 1290 | WP_262599551.1 | restriction endonuclease subunit S | - |
NX720_RS03990 (NX720_03990) | 1030376..1033081 | - | 2706 | WP_262599552.1 | N-6 DNA methylase | - |
NX720_RS03995 (NX720_03995) | 1033274..1033678 | - | 405 | WP_262599553.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 215 a.a. Molecular weight: 25149.69 Da Isoelectric Point: 6.4910
>T254888 WP_262599549.1 NZ_CP103300:c1028873-1028229 [Endozoicomonas euniceicola]
MFYKNLNPQKALIWRITHRNNLPWLLDNGLHCGTSTVRSSDWVDIGNPELIDKRGNHPVPDKPGGVLNDYVPFYFTPFSV
MMQNIHTGWSVPKRDNDEIVILVSSLYRIRELELPFLFTDSHAYYMWANFYSGLADLDKVDWSILQRRDFKRDQDDPAKF
ERYQAEALVYRHVPVEALLGVVCYTEELKLQIDQLMQQRGLGLSVYVRTGWYFQ
MFYKNLNPQKALIWRITHRNNLPWLLDNGLHCGTSTVRSSDWVDIGNPELIDKRGNHPVPDKPGGVLNDYVPFYFTPFSV
MMQNIHTGWSVPKRDNDEIVILVSSLYRIRELELPFLFTDSHAYYMWANFYSGLADLDKVDWSILQRRDFKRDQDDPAKF
ERYQAEALVYRHVPVEALLGVVCYTEELKLQIDQLMQQRGLGLSVYVRTGWYFQ
Download Length: 645 bp
Antitoxin
Download Length: 358 a.a. Molecular weight: 40583.11 Da Isoelectric Point: 8.5671
>AT254888 WP_262599547.1 NZ_CP103300:c1028232-1027159 [Endozoicomonas euniceicola]
MIKYTTGNLLDAPAEALVNTVNTVGVMGKGIALMFKERFDKNMKEYVKACKAKEVQVGKMFVTKTDELIGPHWVVNFPTK
KHWRYPSKMEWVVDGLQDLKRFILEENVRSIAIPPLGAGNGGLPWPAVREQIELALSDLHDVEILIFEPTAKYQNIAKSK
GAEKLTPARALIAELIRRYWVPGMECSLLEVQKLAWVLERVIEKQQLENPLQLQFSPENYGPYANRLQHVLNHLDGSYLK
SDKRIADSSPLDVIRFNEKYKIKLQTYLESKATKYLPALEEASKIISGFESPFGLELLTTVDWLISRESCNGTVDDVMEA
IKQWPAGSKWASRKEKLFSERDVSIALSRLQEMKMAA
MIKYTTGNLLDAPAEALVNTVNTVGVMGKGIALMFKERFDKNMKEYVKACKAKEVQVGKMFVTKTDELIGPHWVVNFPTK
KHWRYPSKMEWVVDGLQDLKRFILEENVRSIAIPPLGAGNGGLPWPAVREQIELALSDLHDVEILIFEPTAKYQNIAKSK
GAEKLTPARALIAELIRRYWVPGMECSLLEVQKLAWVLERVIEKQQLENPLQLQFSPENYGPYANRLQHVLNHLDGSYLK
SDKRIADSSPLDVIRFNEKYKIKLQTYLESKATKYLPALEEASKIISGFESPFGLELLTTVDWLISRESCNGTVDDVMEA
IKQWPAGSKWASRKEKLFSERDVSIALSRLQEMKMAA
Download Length: 1074 bp