Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 635645..636318 | Replicon | chromosome |
| Accession | NZ_CP103300 | ||
| Organism | Endozoicomonas euniceicola strain EF212 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | - |
| Locus tag | NX720_RS02425 | Protein ID | WP_262599156.1 |
| Coordinates | 635965..636318 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | - |
| Locus tag | NX720_RS02420 | Protein ID | WP_262568332.1 |
| Coordinates | 635645..635968 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NX720_RS02390 (NX720_02390) | 630683..632665 | - | 1983 | WP_262599151.1 | hypothetical protein | - |
| NX720_RS02395 (NX720_02395) | 632964..633488 | - | 525 | WP_262599152.1 | crossover junction endodeoxyribonuclease RuvC | - |
| NX720_RS02400 (NX720_02400) | 633630..633758 | + | 129 | WP_262599154.1 | hypothetical protein | - |
| NX720_RS02405 (NX720_02405) | 633829..634257 | - | 429 | WP_262595354.1 | IS200/IS605 family transposase | - |
| NX720_RS02410 (NX720_02410) | 634323..635201 | + | 879 | WP_262599155.1 | transposase | - |
| NX720_RS02415 (NX720_02415) | 635211..635495 | + | 285 | WP_262601704.1 | transposase | - |
| NX720_RS02420 (NX720_02420) | 635645..635968 | - | 324 | WP_262568332.1 | XRE family transcriptional regulator | Antitoxin |
| NX720_RS02425 (NX720_02425) | 635965..636318 | - | 354 | WP_262599156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NX720_RS02430 (NX720_02430) | 636565..636879 | - | 315 | WP_262599157.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NX720_RS02435 (NX720_02435) | 636857..637117 | - | 261 | WP_262599158.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| NX720_RS02440 (NX720_02440) | 637316..639544 | - | 2229 | WP_262599159.1 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 633829..634257 | 428 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13435.37 Da Isoelectric Point: 10.1648
>T254887 WP_262599156.1 NZ_CP103300:c636318-635965 [Endozoicomonas euniceicola]
MSNEKPIKWMGSALDDLLQFPDPAKREAGYQLSRIQNDLEPEHWKDFKMVGAGAKGIIISEDGDAFRVMYVAKFEEAVYV
LHSFQKKTQQTSKQDKQIASRRYKQVVAERSKKRKGG
MSNEKPIKWMGSALDDLLQFPDPAKREAGYQLSRIQNDLEPEHWKDFKMVGAGAKGIIISEDGDAFRVMYVAKFEEAVYV
LHSFQKKTQQTSKQDKQIASRRYKQVVAERSKKRKGG
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|