Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 51394..52037 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP103297 | ||
| Organism | Escherichia coli strain 2e | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | NW892_RS23750 | Protein ID | WP_001044768.1 |
| Coordinates | 51621..52037 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | NW892_RS23745 | Protein ID | WP_001261287.1 |
| Coordinates | 51394..51624 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW892_RS23725 (46554) | 46554..47642 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
| NW892_RS23730 (47644) | 47644..49869 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| NW892_RS23735 (49919) | 49919..50818 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| NW892_RS23740 (50808) | 50808..51098 | - | 291 | WP_000111771.1 | hypothetical protein | - |
| NW892_RS23745 (51394) | 51394..51624 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NW892_RS23750 (51621) | 51621..52037 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NW892_RS23755 (52199) | 52199..54337 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
| NW892_RS23760 (54691) | 54691..54948 | + | 258 | WP_000343085.1 | hypothetical protein | - |
| NW892_RS23765 (54948) | 54948..55538 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | fosA3 / blaTEM-1B / blaCTX-M-55 / rmtB / floR / tet(A) / aph(6)-Id | - | 1..64018 | 64018 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T254886 WP_001044768.1 NZ_CP103297:51621-52037 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |