Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 4716033..4716833 | Replicon | chromosome |
| Accession | NZ_CP103295 | ||
| Organism | Escherichia coli strain 2e | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4NNI0 |
| Locus tag | NW892_RS22720 | Protein ID | WP_000342449.1 |
| Coordinates | 4716033..4716560 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | NW892_RS22725 | Protein ID | WP_001277108.1 |
| Coordinates | 4716567..4716833 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW892_RS22695 (4711108) | 4711108..4711875 | - | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NW892_RS22700 (4711872) | 4711872..4713149 | - | 1278 | WP_000803799.1 | branched chain amino acid ABC transporter permease LivM | - |
| NW892_RS22705 (4713146) | 4713146..4714072 | - | 927 | WP_000003004.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NW892_RS22710 (4714120) | 4714120..4715229 | - | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NW892_RS22715 (4715653) | 4715653..4716036 | + | 384 | WP_000778781.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| NW892_RS22720 (4716033) | 4716033..4716560 | - | 528 | WP_000342449.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| NW892_RS22725 (4716567) | 4716567..4716833 | - | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| NW892_RS22730 (4716983) | 4716983..4718086 | - | 1104 | WP_001350438.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| NW892_RS22735 (4718358) | 4718358..4719212 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| NW892_RS22740 (4719457) | 4719457..4720515 | - | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| NW892_RS22745 (4720508) | 4720508..4721176 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T254875 WP_000342449.1 NZ_CP103295:c4716560-4716033 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLZ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6GTS | |
| PDB | 6AJN | |
| PDB | 6GTQ | |
| PDB | 6GTO | |
| PDB | 6GTR | |
| PDB | 6AJM | |
| AlphaFold DB | A0A829CN24 |