Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4151301..4151955 | Replicon | chromosome |
| Accession | NZ_CP103295 | ||
| Organism | Escherichia coli strain 2e | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | NW892_RS19875 | Protein ID | WP_000244777.1 |
| Coordinates | 4151301..4151708 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NW892_RS19880 | Protein ID | WP_000354046.1 |
| Coordinates | 4151689..4151955 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW892_RS19855 (4147258) | 4147258..4148991 | - | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NW892_RS19860 (4148997) | 4148997..4149707 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NW892_RS19865 (4149732) | 4149732..4150628 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NW892_RS19870 (4150740) | 4150740..4151261 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NW892_RS19875 (4151301) | 4151301..4151708 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
| NW892_RS19880 (4151689) | 4151689..4151955 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NW892_RS19885 (4152198) | 4152198..4153178 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| NW892_RS19890 (4153255) | 4153255..4153914 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NW892_RS19895 (4154078) | 4154078..4154389 | - | 312 | WP_001679467.1 | N(4)-acetylcytidine aminohydrolase | - |
| NW892_RS19900 (4154434) | 4154434..4155867 | + | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| NW892_RS19905 (4155924) | 4155924..4156667 | - | 744 | Protein_3872 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T254872 WP_000244777.1 NZ_CP103295:c4151708-4151301 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |