Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 4008444..4009027 | Replicon | chromosome |
| Accession | NZ_CP103295 | ||
| Organism | Escherichia coli strain 2e | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | NW892_RS19220 | Protein ID | WP_000254738.1 |
| Coordinates | 4008444..4008779 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | NW892_RS19225 | Protein ID | WP_000581937.1 |
| Coordinates | 4008779..4009027 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW892_RS19205 (4004330) | 4004330..4005628 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| NW892_RS19210 (4005717) | 4005717..4007354 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| NW892_RS19215 (4007582) | 4007582..4008373 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| NW892_RS19220 (4008444) | 4008444..4008779 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| NW892_RS19225 (4008779) | 4008779..4009027 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW892_RS19230 (4009105) | 4009105..4011339 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| NW892_RS19235 (4011387) | 4011387..4012688 | - | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4003398..4016786 | 13388 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T254871 WP_000254738.1 NZ_CP103295:c4008779-4008444 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|