Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3710335..3710960 | Replicon | chromosome |
| Accession | NZ_CP103295 | ||
| Organism | Escherichia coli strain 2e | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NW892_RS17780 | Protein ID | WP_000911330.1 |
| Coordinates | 3710335..3710733 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NW892_RS17785 | Protein ID | WP_000450524.1 |
| Coordinates | 3710733..3710960 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW892_RS17760 (3706213) | 3706213..3706413 | + | 201 | WP_000383836.1 | YpfN family protein | - |
| NW892_RS17765 (3706523) | 3706523..3707221 | - | 699 | WP_000679823.1 | esterase | - |
| NW892_RS17770 (3707295) | 3707295..3709310 | - | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NW892_RS17775 (3709325) | 3709325..3710188 | - | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| NW892_RS17780 (3710335) | 3710335..3710733 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NW892_RS17785 (3710733) | 3710733..3710960 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NW892_RS17790 (3711114) | 3711114..3711827 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NW892_RS17795 (3712040) | 3712040..3713074 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| NW892_RS17800 (3713091) | 3713091..3713969 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NW892_RS17805 (3714115) | 3714115..3714687 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| NW892_RS17810 (3714687) | 3714687..3715157 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T254869 WP_000911330.1 NZ_CP103295:c3710733-3710335 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|