Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3733434..3734070 | Replicon | chromosome |
Accession | NZ_CP103290 | ||
Organism | Bacillus atrophaeus strain NS2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NXY85_RS18950 | Protein ID | WP_003156187.1 |
Coordinates | 3733720..3734070 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A837XXL9 |
Locus tag | NXY85_RS18945 | Protein ID | WP_003328141.1 |
Coordinates | 3733434..3733715 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NXY85_RS18925 | 3729730..3730329 | - | 600 | WP_258728654.1 | rhomboid family intramembrane serine protease | - |
NXY85_RS18930 | 3730429..3730794 | + | 366 | WP_061669621.1 | holo-ACP synthase | - |
NXY85_RS18935 | 3730962..3731978 | + | 1017 | WP_106034464.1 | outer membrane lipoprotein carrier protein LolA | - |
NXY85_RS18940 | 3732146..3733315 | + | 1170 | WP_010789628.1 | alanine racemase | - |
NXY85_RS18945 | 3733434..3733715 | + | 282 | WP_003328141.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NXY85_RS18950 | 3733720..3734070 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NXY85_RS18955 | 3734186..3735004 | + | 819 | WP_061572303.1 | RsbT co-antagonist protein RsbRA | - |
NXY85_RS18960 | 3735009..3735374 | + | 366 | WP_010789626.1 | RsbT antagonist protein RsbS | - |
NXY85_RS18965 | 3735377..3735778 | + | 402 | WP_003328144.1 | serine/threonine-protein kinase RsbT | - |
NXY85_RS18970 | 3735790..3736797 | + | 1008 | WP_151291230.1 | PP2C family protein-serine/threonine phosphatase | - |
NXY85_RS18975 | 3736857..3737186 | + | 330 | WP_003328146.1 | anti-sigma factor antagonist RsbV | - |
NXY85_RS18980 | 3737183..3737665 | + | 483 | WP_003328147.1 | anti-sigma B factor RsbW | - |
NXY85_RS18985 | 3737631..3738419 | + | 789 | WP_003328149.1 | RNA polymerase sigma factor SigB | - |
NXY85_RS18990 | 3738419..3739018 | + | 600 | WP_003328150.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T254857 WP_003156187.1 NZ_CP103290:3733720-3734070 [Bacillus atrophaeus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4MDX | |
PDB | 4ME7 | |
PDB | 1NE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837XXL9 |