Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 446438..447081 | Replicon | chromosome |
Accession | NZ_CP103289 | ||
Organism | Cellulomonas sp. NS3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NXY84_RS02075 | Protein ID | WP_258725523.1 |
Coordinates | 446438..446821 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NXY84_RS02080 | Protein ID | WP_258725524.1 |
Coordinates | 446818..447081 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NXY84_RS02055 | 441799..442914 | + | 1116 | WP_258725519.1 | serine protease | - |
NXY84_RS02060 | 442943..444232 | - | 1290 | WP_258725520.1 | hypothetical protein | - |
NXY84_RS02065 | 444311..445204 | + | 894 | WP_258725521.1 | helix-turn-helix transcriptional regulator | - |
NXY84_RS02070 | 445317..446357 | + | 1041 | WP_258725522.1 | NAD(P)-dependent alcohol dehydrogenase | - |
NXY84_RS02075 | 446438..446821 | - | 384 | WP_258725523.1 | PIN domain-containing protein | Toxin |
NXY84_RS02080 | 446818..447081 | - | 264 | WP_258725524.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NXY84_RS02085 | 447155..447454 | - | 300 | WP_258725525.1 | hypothetical protein | - |
NXY84_RS02090 | 447444..449063 | - | 1620 | WP_258725526.1 | TROVE domain-containing protein | - |
NXY84_RS02095 | 449907..451073 | + | 1167 | WP_258725527.1 | hypothetical protein | - |
NXY84_RS02100 | 451124..451276 | - | 153 | WP_258725528.1 | hypothetical protein | - |
NXY84_RS02105 | 451287..451631 | - | 345 | WP_258727094.1 | DUF1796 family putative cysteine peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13245.32 Da Isoelectric Point: 6.4691
>T254855 WP_258725523.1 NZ_CP103289:c446821-446438 [Cellulomonas sp. NS3]
VRLILDTNVLIDRLVPTGRGDEAAISMATLAELRFGVLMARTPESRAARMRVLSGAESALTALPIDDAVASSYALLATKT
VAAGRQPRARAFDLLIAATAHAHGGVLITSPVGDFAGLEGVLEVREP
VRLILDTNVLIDRLVPTGRGDEAAISMATLAELRFGVLMARTPESRAARMRVLSGAESALTALPIDDAVASSYALLATKT
VAAGRQPRARAFDLLIAATAHAHGGVLITSPVGDFAGLEGVLEVREP
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|