Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 1220255..1220781 | Replicon | chromosome |
| Accession | NZ_CP103288 | ||
| Organism | Pseudarthrobacter sp. NS4 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NXY83_RS05755 | Protein ID | WP_258805119.1 |
| Coordinates | 1220455..1220781 (+) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | NXY83_RS05750 | Protein ID | WP_258805118.1 |
| Coordinates | 1220255..1220458 (+) | Length | 68 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NXY83_RS05725 | 1215653..1216573 | + | 921 | WP_258805112.1 | ABC transporter permease | - |
| NXY83_RS05730 | 1216570..1217418 | + | 849 | WP_258805113.1 | ABC transporter ATP-binding protein | - |
| NXY83_RS05735 | 1217415..1218311 | + | 897 | WP_258805114.1 | ATP-binding cassette domain-containing protein | - |
| NXY83_RS05740 | 1218311..1219288 | + | 978 | WP_258805116.1 | aldo/keto reductase | - |
| NXY83_RS05745 | 1219358..1220119 | + | 762 | WP_258805117.1 | aldolase/citrate lyase family protein | - |
| NXY83_RS05750 | 1220255..1220458 | + | 204 | WP_258805118.1 | antitoxin MazE family protein | Antitoxin |
| NXY83_RS05755 | 1220455..1220781 | + | 327 | WP_258805119.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NXY83_RS05760 | 1220867..1221214 | - | 348 | WP_258806078.1 | PH domain-containing protein | - |
| NXY83_RS05765 | 1221292..1221768 | - | 477 | WP_258805120.1 | HNH endonuclease signature motif containing protein | - |
| NXY83_RS05770 | 1221964..1223172 | - | 1209 | WP_258806079.1 | DUF3322 and DUF2220 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11647.37 Da Isoelectric Point: 4.5557
>T254854 WP_258805119.1 NZ_CP103288:1220455-1220781 [Pseudarthrobacter sp. NS4]
VNRGELWTVSGGIYAQKPRPALIIQDDLFEASESVTLLPLTSQLTDAPILRLTVEPGDLTGLERESQIMVDKLTTVRRAN
LGQRVGQVDAKTMAAVEQSLAVFLGLGS
VNRGELWTVSGGIYAQKPRPALIIQDDLFEASESVTLLPLTSQLTDAPILRLTVEPGDLTGLERESQIMVDKLTTVRRAN
LGQRVGQVDAKTMAAVEQSLAVFLGLGS
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|