Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 3323620..3324212 Replicon chromosome
Accession NZ_CP103250
Organism Bacteroides uniformis strain BFG-227

Toxin (Protein)


Gene name hicA Uniprot ID A0A4P6RLL2
Locus tag NXX72_RS13515 Protein ID WP_061412731.1
Coordinates 3323961..3324212 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A4P6RLY3
Locus tag NXX72_RS13510 Protein ID WP_061412725.1
Coordinates 3323620..3323964 (-) Length 115 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NXX72_RS13480 (NXX72_13480) 3319237..3320850 - 1614 WP_016272705.1 IS21 family transposase -
NXX72_RS13485 (NXX72_13485) 3321092..3321532 + 441 WP_225982713.1 DUF551 domain-containing protein -
NXX72_RS13490 (NXX72_13490) 3321535..3321954 + 420 WP_061412713.1 hypothetical protein -
NXX72_RS13495 (NXX72_13495) 3322141..3322398 + 258 WP_061412776.1 hypothetical protein -
NXX72_RS13500 (NXX72_13500) 3322627..3322806 + 180 WP_061412716.1 hypothetical protein -
NXX72_RS13505 (NXX72_13505) 3322896..3323333 + 438 WP_061412719.1 hypothetical protein -
NXX72_RS13510 (NXX72_13510) 3323620..3323964 - 345 WP_061412725.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NXX72_RS13515 (NXX72_13515) 3323961..3324212 - 252 WP_061412731.1 type II toxin-antitoxin system HicA family toxin Toxin
NXX72_RS13520 (NXX72_13520) 3324265..3324516 - 252 WP_258896241.1 XRE family transcriptional regulator -
NXX72_RS13525 (NXX72_13525) 3324828..3325010 + 183 WP_234146015.1 hypothetical protein -
NXX72_RS13530 (NXX72_13530) 3325021..3325269 + 249 WP_061412738.1 hypothetical protein -
NXX72_RS13535 (NXX72_13535) 3325339..3325512 + 174 WP_225982714.1 hypothetical protein -
NXX72_RS13540 (NXX72_13540) 3325555..3325752 + 198 WP_061412741.1 hypothetical protein -
NXX72_RS13545 (NXX72_13545) 3325765..3325971 + 207 WP_081106205.1 DUF3873 family protein -
NXX72_RS13555 (NXX72_13555) 3326147..3326536 + 390 WP_061412744.1 hypothetical protein -
NXX72_RS13560 (NXX72_13560) 3326763..3327461 + 699 WP_061412747.1 phosphoadenosine phosphosulfate reductase family protein -
NXX72_RS13565 (NXX72_13565) 3327427..3328224 + 798 WP_061412749.1 hypothetical protein -
NXX72_RS13570 (NXX72_13570) 3328224..3328601 + 378 WP_061412752.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3314828..3369958 55130


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-74)

Antitoxin

Uncharacterised protein family HicB

(56-105)


Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9572.16 Da        Isoelectric Point: 10.5589

>T254853 WP_061412731.1 NZ_CP103250:c3324212-3323961 [Bacteroides uniformis]
MGTKEKLIERFKSQPKDFNWDELVRLFSIFGYKIDNKGKTSGSRVIFAKGESSYTAHKPHPGSIVKGYVMKQVFEFLTKN
KLI

Download         Length: 252 bp

Antitoxin


Download         Length: 115 a.a.        Molecular weight: 12515.36 Da        Isoelectric Point: 4.8722

>AT254853 WP_061412725.1 NZ_CP103250:c3323964-3323620 [Bacteroides uniformis]
MKTLTYKGYIGSIEISDEDNCLFGKVLDLPKDTMISYEGETVSELKEDFKGAVDDYIAYCKEAGITPRKSYSGSLNIRIS
PEVHSKIAILAQQAGISINAFIKSAVEKQVATML

Download         Length: 345 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P6RLL2

Antitoxin

Source ID Structure
AlphaFold DB A0A4P6RLY3

References