Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-yefM/Txe-RelB |
| Location | 6250157..6250677 | Replicon | chromosome |
| Accession | NZ_CP103068 | ||
| Organism | Bacteroides sp. BFG-257 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NXV86_RS25030 | Protein ID | WP_224320138.1 |
| Coordinates | 6250408..6250677 (+) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | NXV86_RS25025 | Protein ID | WP_224320137.1 |
| Coordinates | 6250157..6250411 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NXV86_RS25005 (NXV86_25005) | 6245209..6245763 | - | 555 | WP_217714731.1 | RNA polymerase sigma-70 factor | - |
| NXV86_RS25010 (NXV86_25010) | 6245921..6247666 | + | 1746 | WP_224320136.1 | pectate lyase | - |
| NXV86_RS25015 (NXV86_25015) | 6247841..6248542 | + | 702 | WP_007664170.1 | nitrogen-fixing protein NifU | - |
| NXV86_RS25020 (NXV86_25020) | 6248562..6249573 | + | 1012 | Protein_4932 | GGGtGRT protein | - |
| NXV86_RS25025 (NXV86_25025) | 6250157..6250411 | + | 255 | WP_224320137.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| NXV86_RS25030 (NXV86_25030) | 6250408..6250677 | + | 270 | WP_224320138.1 | Txe/YoeB family addiction module toxin | Toxin |
| NXV86_RS25035 (NXV86_25035) | 6251249..6252073 | + | 825 | WP_258771085.1 | leucine-rich repeat domain-containing protein | - |
| NXV86_RS25040 (NXV86_25040) | 6252027..6252848 | + | 822 | WP_258771086.1 | leucine-rich repeat domain-containing protein | - |
| NXV86_RS25045 (NXV86_25045) | 6253598..6255556 | + | 1959 | WP_224320140.1 | LruC domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10844.65 Da Isoelectric Point: 10.1205
>T254849 WP_224320138.1 NZ_CP103068:6250408-6250677 [Bacteroides sp. BFG-257]
MKVIFSPLAMEQWEYWKKNNPNIAKRIKKILLDIREHPYTGIAKPEPLKYDLAGKWSRRINEEHRIIYSVNDDRIEIDIL
SMRYHYSKK
MKVIFSPLAMEQWEYWKKNNPNIAKRIKKILLDIREHPYTGIAKPEPLKYDLAGKWSRRINEEHRIIYSVNDDRIEIDIL
SMRYHYSKK
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|