Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 4070265..4070892 | Replicon | chromosome |
Accession | NZ_CP103057 | ||
Organism | Sphingomonas sp. ZFBP2030 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NV382_RS19445 | Protein ID | WP_260598505.1 |
Coordinates | 4070485..4070892 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NV382_RS19440 | Protein ID | WP_260598504.1 |
Coordinates | 4070265..4070495 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV382_RS19420 | 4066255..4066998 | - | 744 | WP_260598500.1 | class I SAM-dependent methyltransferase | - |
NV382_RS19425 | 4067055..4067867 | + | 813 | WP_260598501.1 | bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase | - |
NV382_RS19430 | 4067977..4068240 | + | 264 | WP_260598502.1 | 30S ribosomal protein S20 | - |
NV382_RS19435 | 4068708..4070093 | + | 1386 | WP_260598503.1 | chromosomal replication initiator protein DnaA | - |
NV382_RS19440 | 4070265..4070495 | + | 231 | WP_260598504.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NV382_RS19445 | 4070485..4070892 | + | 408 | WP_260598505.1 | PIN domain-containing protein | Toxin |
NV382_RS19450 | 4071000..4072007 | - | 1008 | WP_260598506.1 | tryptophan--tRNA ligase | - |
NV382_RS19455 | 4072019..4073593 | - | 1575 | WP_260598507.1 | murein biosynthesis integral membrane protein MurJ | - |
NV382_RS19460 | 4073734..4074249 | - | 516 | WP_260598508.1 | protein-export chaperone SecB | - |
NV382_RS19465 | 4074480..4075124 | + | 645 | WP_260598509.1 | Tim44/TimA family putative adaptor protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14549.71 Da Isoelectric Point: 4.6736
>T254827 WP_260598505.1 NZ_CP103057:4070485-4070892 [Sphingomonas sp. ZFBP2030]
MPGSFFDSNVPLSVAVGDDAKANLAEQLLSSGGIVSVQVLNEVANVALRKYGFTIPEVVTFIDSLRFVVKVVPVTVETHE
VALIVRERHRFAFHDCAIVAAALLADCETLWSEDMHDGLVVDGRLTIRNPFAGAA
MPGSFFDSNVPLSVAVGDDAKANLAEQLLSSGGIVSVQVLNEVANVALRKYGFTIPEVVTFIDSLRFVVKVVPVTVETHE
VALIVRERHRFAFHDCAIVAAALLADCETLWSEDMHDGLVVDGRLTIRNPFAGAA
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|