Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 316162..316736 Replicon chromosome
Accession NZ_CP103054
Organism Pseudomonas mosselii strain P33

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NW905_RS01455 Protein ID WP_232532261.1
Coordinates 316162..316305 (+) Length 48 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NW905_RS01460 Protein ID WP_096048930.1
Coordinates 316323..316736 (+) Length 138 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW905_RS01435 (NW905_01435) 311464..312522 + 1059 WP_258800649.1 putative 2-aminoethylphosphonate ABC transporter ATP-binding protein -
NW905_RS01440 (NW905_01440) 312524..314248 + 1725 WP_258800650.1 putative 2-aminoethylphosphonate ABC transporter permease subunit -
NW905_RS01445 (NW905_01445) 314279..315301 + 1023 WP_258800651.1 putative 2-aminoethylphosphonate ABC transporter substrate-binding protein -
NW905_RS01450 (NW905_01450) 315393..315938 + 546 WP_096048931.1 HD domain-containing protein -
NW905_RS01455 (NW905_01455) 316162..316305 + 144 WP_232532261.1 type II toxin-antitoxin system HicA family toxin Toxin
NW905_RS01460 (NW905_01460) 316323..316736 + 414 WP_096048930.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NW905_RS01465 (NW905_01465) 316849..317100 + 252 WP_096048929.1 helix-turn-helix domain-containing protein -
NW905_RS01470 (NW905_01470) 317100..318290 + 1191 WP_096050265.1 type II toxin-antitoxin system HipA family toxin -
NW905_RS01475 (NW905_01475) 318271..318480 - 210 WP_096048928.1 DUF3079 domain-containing protein -
NW905_RS01480 (NW905_01480) 318558..319703 - 1146 WP_096048927.1 copper-containing nitrite reductase -
NW905_RS01490 (NW905_01490) 320033..320239 - 207 WP_051555605.1 hypothetical protein -
NW905_RS01495 (NW905_01495) 320307..320687 - 381 WP_062572530.1 hypothetical protein -
NW905_RS01500 (NW905_01500) 320706..320912 - 207 WP_023629980.1 helix-turn-helix transcriptional regulator -
NW905_RS01505 (NW905_01505) 320922..321500 - 579 WP_096048926.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(1-42)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 48 a.a.        Molecular weight: 5154.03 Da        Isoelectric Point: 11.3320

>T254826 WP_232532261.1 NZ_CP103054:316162-316305 [Pseudomonas mosselii]
MVRSKGSHHHFKHPEKAGLVTIPHPKKDLLPATAASILRQARIGYAS

Download         Length: 144 bp

Antitoxin


Download         Length: 138 a.a.        Molecular weight: 14934.03 Da        Isoelectric Point: 4.5801

>AT254826 WP_096048930.1 NZ_CP103054:316323-316736 [Pseudomonas mosselii]
MLFPIAILPGDDQHAWGVEVPDIPGCFSAGEDLDNAIAMAREAIEGHLELLAQDQQEIPKASLVSVHAANPAYAGCTWAL
IDIDITRYLGKAEKLNITLPAYLLTRIDSYVQNHPEHKSRSGFLAEAALRILQGDCK

Download         Length: 414 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References