Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 43794..44446 | Replicon | plasmid p2 |
Accession | NZ_CP102995 | ||
Organism | Klebsiella pneumoniae strain KPA3 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A8A2Q2K1 |
Locus tag | NW255_RS26900 | Protein ID | WP_017901321.1 |
Coordinates | 44021..44446 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A853H7M9 |
Locus tag | NW255_RS26895 | Protein ID | WP_001261275.1 |
Coordinates | 43794..44024 (+) | Length | 77 a.a. |
Genomic Context
Location: 40965..43541 (2577 bp)
Type: Others
Protein ID: WP_017901322.1
Type: Others
Protein ID: WP_017901322.1
Location: 43794..44024 (231 bp)
Type: Antitoxin
Protein ID: WP_001261275.1
Type: Antitoxin
Protein ID: WP_001261275.1
Location: 44021..44446 (426 bp)
Type: Toxin
Protein ID: WP_017901321.1
Type: Toxin
Protein ID: WP_017901321.1
Location: 44464..45432 (969 bp)
Type: Others
Protein ID: WP_077254762.1
Type: Others
Protein ID: WP_077254762.1
Location: 45491..46027 (537 bp)
Type: Others
Protein ID: Protein_50
Type: Others
Protein ID: Protein_50
Location: 46080..46253 (174 bp)
Type: Others
Protein ID: Protein_51
Type: Others
Protein ID: Protein_51
Location: 46440..47996 (1557 bp)
Type: Others
Protein ID: WP_025999314.1
Type: Others
Protein ID: WP_025999314.1
Location: 48326..48496 (171 bp)
Type: Others
Protein ID: Protein_54
Type: Others
Protein ID: Protein_54
Location: 48088..48315 (228 bp)
Type: Others
Protein ID: Protein_53
Type: Others
Protein ID: Protein_53
Location: 48621..48737 (117 bp)
Type: Others
Protein ID: Protein_55
Type: Others
Protein ID: Protein_55
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW255_RS26890 (NW255_26890) | 40965..43541 | + | 2577 | WP_017901322.1 | nuclease domain-containing protein | - |
NW255_RS26895 (NW255_26895) | 43794..44024 | + | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NW255_RS26900 (NW255_26900) | 44021..44446 | + | 426 | WP_017901321.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NW255_RS26905 (NW255_26905) | 44464..45432 | + | 969 | WP_077254762.1 | IS5 family transposase | - |
NW255_RS26910 (NW255_26910) | 45491..46027 | + | 537 | Protein_50 | integrase core domain-containing protein | - |
NW255_RS26915 (NW255_26915) | 46080..46253 | + | 174 | Protein_51 | nuclease | - |
NW255_RS26920 (NW255_26920) | 46440..47996 | + | 1557 | WP_025999314.1 | sensor domain-containing diguanylate cyclase | - |
NW255_RS26925 (NW255_26925) | 48088..48315 | - | 228 | Protein_53 | IS3 family transposase | - |
NW255_RS26930 (NW255_26930) | 48326..48496 | + | 171 | Protein_54 | LysR family transcriptional regulator | - |
NW255_RS26935 (NW255_26935) | 48621..48737 | - | 117 | Protein_55 | transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | catA1 / tet(D) | - | 1..121101 | 121101 | |
- | flank | IS/Tn | - | - | 44464..45432 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15412.91 Da Isoelectric Point: 7.1364
>T254824 WP_017901321.1 NZ_CP102995:44021-44446 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
Download Length: 426 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8A2Q2K1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A853H7M9 |