Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 43794..44446 | Replicon | plasmid p2 |
| Accession | NZ_CP102995 | ||
| Organism | Klebsiella pneumoniae strain KPA3 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A8A2Q2K1 |
| Locus tag | NW255_RS26900 | Protein ID | WP_017901321.1 |
| Coordinates | 44021..44446 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A853H7M9 |
| Locus tag | NW255_RS26895 | Protein ID | WP_001261275.1 |
| Coordinates | 43794..44024 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW255_RS26890 (NW255_26890) | 40965..43541 | + | 2577 | WP_017901322.1 | nuclease domain-containing protein | - |
| NW255_RS26895 (NW255_26895) | 43794..44024 | + | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NW255_RS26900 (NW255_26900) | 44021..44446 | + | 426 | WP_017901321.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NW255_RS26905 (NW255_26905) | 44464..45432 | + | 969 | WP_077254762.1 | IS5 family transposase | - |
| NW255_RS26910 (NW255_26910) | 45491..46027 | + | 537 | Protein_50 | integrase core domain-containing protein | - |
| NW255_RS26915 (NW255_26915) | 46080..46253 | + | 174 | Protein_51 | nuclease | - |
| NW255_RS26920 (NW255_26920) | 46440..47996 | + | 1557 | WP_025999314.1 | sensor domain-containing diguanylate cyclase | - |
| NW255_RS26925 (NW255_26925) | 48088..48315 | - | 228 | Protein_53 | IS3 family transposase | - |
| NW255_RS26930 (NW255_26930) | 48326..48496 | + | 171 | Protein_54 | LysR family transcriptional regulator | - |
| NW255_RS26935 (NW255_26935) | 48621..48737 | - | 117 | Protein_55 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | catA1 / tet(D) | - | 1..121101 | 121101 | |
| - | flank | IS/Tn | - | - | 44464..45432 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15412.91 Da Isoelectric Point: 7.1364
>T254824 WP_017901321.1 NZ_CP102995:44021-44446 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8A2Q2K1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A853H7M9 |