Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3983999..3984618 Replicon chromosome
Accession NZ_CP102993
Organism Klebsiella pneumoniae strain KPA3

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NW255_RS19690 Protein ID WP_002892050.1
Coordinates 3984400..3984618 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NW255_RS19685 Protein ID WP_002892066.1
Coordinates 3983999..3984373 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW255_RS19675 (3979151) 3979151..3980344 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NW255_RS19680 (3980367) 3980367..3983513 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NW255_RS19685 (3983999) 3983999..3984373 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NW255_RS19690 (3984400) 3984400..3984618 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NW255_RS19695 (3984777) 3984777..3985343 + 567 WP_002892030.1 maltose O-acetyltransferase -
NW255_RS19700 (3985315) 3985315..3985455 - 141 WP_004147370.1 hypothetical protein -
NW255_RS19705 (3985476) 3985476..3985946 + 471 WP_002892026.1 YlaC family protein -
NW255_RS19710 (3985921) 3985921..3987372 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NW255_RS19715 (3987473) 3987473..3988171 + 699 WP_002892021.1 GNAT family protein -
NW255_RS19720 (3988168) 3988168..3988308 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NW255_RS19725 (3988308) 3988308..3988571 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254819 WP_002892050.1 NZ_CP102993:3984400-3984618 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254819 WP_002892066.1 NZ_CP102993:3983999-3984373 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References