Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 95468..96111 | Replicon | plasmid p1 |
Accession | NZ_CP102988 | ||
Organism | Klebsiella pneumoniae strain KPA2 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A155IU92 |
Locus tag | NW253_RS26360 | Protein ID | WP_000754567.1 |
Coordinates | 95695..96111 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A853H7M9 |
Locus tag | NW253_RS26355 | Protein ID | WP_001261275.1 |
Coordinates | 95468..95698 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW253_RS26350 (NW253_26350) | 92639..95215 | + | 2577 | WP_017901322.1 | nuclease domain-containing protein | - |
NW253_RS26355 (NW253_26355) | 95468..95698 | + | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NW253_RS26360 (NW253_26360) | 95695..96111 | + | 417 | WP_000754567.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NW253_RS26365 (NW253_26365) | 96419..97387 | + | 969 | WP_016151349.1 | IS5 family transposase | - |
NW253_RS26370 (NW253_26370) | 97558..97977 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | - |
NW253_RS26375 (NW253_26375) | 97974..98285 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | - |
NW253_RS26380 (NW253_26380) | 98490..98927 | - | 438 | Protein_103 | DDE-type integrase/transposase/recombinase | - |
NW253_RS26385 (NW253_26385) | 99041..99379 | + | 339 | WP_023288266.1 | transposase | - |
NW253_RS26390 (NW253_26390) | 99376..99723 | + | 348 | WP_032430752.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | qnrB4 / blaDHA-1 / aph(3')-Ia / mph(A) | - | 1..188688 | 188688 | |
- | inside | IScluster/Tn | - | - | 96419..103049 | 6630 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15108.61 Da Isoelectric Point: 8.5403
>T254807 WP_000754567.1 NZ_CP102988:95695-96111 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A155IU92 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A853H7M9 |