Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3948726..3949345 Replicon chromosome
Accession NZ_CP102987
Organism Klebsiella pneumoniae strain KPA2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NW253_RS19455 Protein ID WP_002892050.1
Coordinates 3949127..3949345 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NW253_RS19450 Protein ID WP_002892066.1
Coordinates 3948726..3949100 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW253_RS19440 (3943878) 3943878..3945071 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NW253_RS19445 (3945094) 3945094..3948240 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NW253_RS19450 (3948726) 3948726..3949100 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NW253_RS19455 (3949127) 3949127..3949345 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NW253_RS19460 (3949508) 3949508..3950074 + 567 WP_002892030.1 maltose O-acetyltransferase -
NW253_RS19465 (3950046) 3950046..3950186 - 141 WP_004147370.1 hypothetical protein -
NW253_RS19470 (3950207) 3950207..3950677 + 471 WP_020802585.1 YlaC family protein -
NW253_RS19475 (3950652) 3950652..3952103 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
NW253_RS19480 (3952204) 3952204..3952902 + 699 WP_023287311.1 GNAT family protein -
NW253_RS19485 (3952899) 3952899..3953039 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NW253_RS19490 (3953039) 3953039..3953302 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254801 WP_002892050.1 NZ_CP102987:3949127-3949345 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254801 WP_002892066.1 NZ_CP102987:3948726-3949100 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References