Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1435118..1435854 | Replicon | chromosome |
Accession | NZ_CP102987 | ||
Organism | Klebsiella pneumoniae strain KPA2 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
Locus tag | NW253_RS07040 | Protein ID | WP_032433360.1 |
Coordinates | 1435372..1435854 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | NW253_RS07035 | Protein ID | WP_003026799.1 |
Coordinates | 1435118..1435384 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW253_RS07010 (1430764) | 1430764..1431903 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
NW253_RS07015 (1431932) | 1431932..1432594 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
NW253_RS07020 (1432578) | 1432578..1433582 | + | 1005 | WP_032433364.1 | dihydroxyacetone kinase subunit DhaK | - |
NW253_RS07025 (1433600) | 1433600..1434232 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
NW253_RS07030 (1434242) | 1434242..1434805 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
NW253_RS07035 (1435118) | 1435118..1435384 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
NW253_RS07040 (1435372) | 1435372..1435854 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
NW253_RS07045 (1436054) | 1436054..1437457 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
NW253_RS07050 (1437486) | 1437486..1438118 | - | 633 | WP_001567369.1 | hypothetical protein | - |
NW253_RS07055 (1438498) | 1438498..1439097 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
NW253_RS07060 (1439310) | 1439310..1440254 | - | 945 | WP_077254249.1 | fimbrial protein | - |
NW253_RS07065 (1440266) | 1440266..1440844 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1403063..1450145 | 47082 | |
- | flank | IS/Tn | - | - | 1436054..1437457 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T254795 WP_032433360.1 NZ_CP102987:1435372-1435854 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |