Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1418427..1419070 | Replicon | chromosome |
| Accession | NZ_CP102987 | ||
| Organism | Klebsiella pneumoniae strain KPA2 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NW253_RS06945 | Protein ID | WP_060588417.1 |
| Coordinates | 1418654..1419070 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A853H7M9 |
| Locus tag | NW253_RS06940 | Protein ID | WP_001261275.1 |
| Coordinates | 1418427..1418657 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW253_RS06925 (1413449) | 1413449..1414536 | + | 1088 | Protein_1350 | transcriptional regulator | - |
| NW253_RS06930 (1414539) | 1414539..1416779 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| NW253_RS06935 (1417307) | 1417307..1418122 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| NW253_RS06940 (1418427) | 1418427..1418657 | + | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NW253_RS06945 (1418654) | 1418654..1419070 | + | 417 | WP_060588417.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NW253_RS06950 (1419226) | 1419226..1420206 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| NW253_RS06955 (1420401) | 1420401..1421972 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| NW253_RS06960 (1422291) | 1422291..1422539 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| NW253_RS06965 (1422598) | 1422598..1423116 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| NW253_RS06970 (1423147) | 1423147..1423638 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| NW253_RS06975 (1423698) | 1423698..1423901 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1403063..1450145 | 47082 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15002.49 Da Isoelectric Point: 7.8921
>T254794 WP_060588417.1 NZ_CP102987:1418654-1419070 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|