Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2046650..2047179 | Replicon | chromosome |
| Accession | NZ_CP102977 | ||
| Organism | Staphylococcus aureus strain 27-G-H | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW957_RS10090 | Protein ID | WP_000621175.1 |
| Coordinates | 2046650..2047012 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW957_RS10095 | Protein ID | WP_000948331.1 |
| Coordinates | 2047009..2047179 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW957_RS10070 (2043628) | 2043628..2044398 | - | 771 | WP_001041108.1 | RNA polymerase sigma factor SigB | - |
| NW957_RS10075 (2044373) | 2044373..2044852 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NW957_RS10080 (2044854) | 2044854..2045180 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW957_RS10085 (2045299) | 2045299..2046300 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW957_RS10090 (2046650) | 2046650..2047012 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW957_RS10095 (2047009) | 2047009..2047179 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW957_RS10100 (2047264) | 2047264..2048412 | - | 1149 | WP_072496962.1 | alanine racemase | - |
| NW957_RS10105 (2048478) | 2048478..2048837 | - | 360 | WP_061838820.1 | holo-ACP synthase | - |
| NW957_RS10110 (2048841) | 2048841..2049332 | - | 492 | WP_072496961.1 | PH domain-containing protein | - |
| NW957_RS10115 (2049319) | 2049319..2050902 | - | 1584 | WP_072496960.1 | PH domain-containing protein | - |
| NW957_RS10120 (2050895) | 2050895..2051374 | - | 480 | WP_001287079.1 | hypothetical protein | - |
| NW957_RS10125 (2051583) | 2051583..2052143 | - | 561 | WP_072496959.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254784 WP_000621175.1 NZ_CP102977:c2047012-2046650 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|