Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1851913..1852689 | Replicon | chromosome |
| Accession | NZ_CP102977 | ||
| Organism | Staphylococcus aureus strain 27-G-H | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | NW957_RS08880 | Protein ID | WP_000031108.1 |
| Coordinates | 1851913..1852065 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | - |
| Locus tag | NW957_RS08885 | Protein ID | WP_165468800.1 |
| Coordinates | 1852090..1852689 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW957_RS08865 (1847882) | 1847882..1848703 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
| NW957_RS08870 (1849164) | 1849164..1850549 | - | 1386 | WP_000116231.1 | class II fumarate hydratase | - |
| NW957_RS08875 (1850745) | 1850745..1851140 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| NW957_RS08880 (1851913) | 1851913..1852065 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| NW957_RS08885 (1852090) | 1852090..1852689 | - | 600 | WP_165468800.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| NW957_RS08890 (1852848) | 1852848..1853318 | - | 471 | WP_165468801.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| NW957_RS08895 (1853323) | 1853323..1854450 | - | 1128 | WP_000379986.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| NW957_RS08900 (1854601) | 1854601..1855323 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| NW957_RS08905 (1855316) | 1855316..1856773 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254779 WP_000031108.1 NZ_CP102977:c1852065-1851913 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22332.49 Da Isoelectric Point: 5.1445
>AT254779 WP_165468800.1 NZ_CP102977:c1852689-1852090 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNTTTIAGFHLDTDLAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNTTTIAGFHLDTDLAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|