Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 817928..818405 Replicon chromosome
Accession NZ_CP102977
Organism Staphylococcus aureus strain 27-G-H

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW957_RS03890 Protein ID WP_000052076.1
Coordinates 817928..818116 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW957_RS03895 Protein ID WP_001059690.1
Coordinates 818145..818405 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW957_RS03860 (813931) 813931..814440 + 510 WP_165468739.1 hypothetical protein -
NW957_RS03865 (814781) 814781..815467 + 687 WP_001641381.1 thermonuclease family protein -
NW957_RS03870 (815824) 815824..816024 + 201 WP_001059082.1 cold-shock protein -
NW957_RS03875 (816519) 816519..816737 - 219 WP_165468738.1 hypothetical protein -
NW957_RS03880 (816799) 816799..817083 - 285 WP_001004401.1 hypothetical protein -
NW957_RS03885 (817171) 817171..817740 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NW957_RS03890 (817928) 817928..818116 - 189 WP_000052076.1 hypothetical protein Toxin
NW957_RS03895 (818145) 818145..818405 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW957_RS03900 (818746) 818746..818949 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW957_RS03905 (818946) 818946..819182 - 237 WP_000368687.1 hypothetical protein -
NW957_RS03910 (819406) 819406..819987 + 582 WP_001140693.1 histidine phosphatase family protein -
NW957_RS03915 (820060) 820060..820677 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
NW957_RS03920 (820832) 820832..821326 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW957_RS03925 (821725) 821725..822147 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
NW957_RS03930 (822295) 822295..823011 + 717 WP_000150012.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254778 WP_000052076.1 NZ_CP102977:c818116-817928 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254778 WP_001059690.1 NZ_CP102977:c818405-818145 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References