Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2079901..2080430 Replicon chromosome
Accession NZ_CP102975
Organism Staphylococcus aureus strain 16CS0209

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag NW953_RS10140 Protein ID WP_000621175.1
Coordinates 2079901..2080263 (-) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag NW953_RS10145 Protein ID WP_000948331.1
Coordinates 2080260..2080430 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW953_RS10115 (NW953_10115) 2075665..2076426 + 762 WP_001066123.1 IS21-like element helper ATPase IstB -
NW953_RS10120 (NW953_10120) 2076879..2077649 - 771 WP_001041107.1 RNA polymerase sigma factor SigB -
NW953_RS10125 (NW953_10125) 2077624..2078103 - 480 WP_001190825.1 anti-sigma B factor RsbW -
NW953_RS10130 (NW953_10130) 2078105..2078431 - 327 WP_001052491.1 anti-sigma factor antagonist -
NW953_RS10135 (NW953_10135) 2078550..2079551 - 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
NW953_RS10140 (NW953_10140) 2079901..2080263 - 363 WP_000621175.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NW953_RS10145 (NW953_10145) 2080260..2080430 - 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
NW953_RS10150 (NW953_10150) 2080515..2081663 - 1149 WP_001281140.1 alanine racemase -
NW953_RS10155 (NW953_10155) 2081729..2082088 - 360 WP_000581197.1 holo-ACP synthase -
NW953_RS10160 (NW953_10160) 2082092..2082583 - 492 WP_001286801.1 PH domain-containing protein -
NW953_RS10165 (NW953_10165) 2082576..2084153 - 1578 WP_258409293.1 PH domain-containing protein -
NW953_RS10170 (NW953_10170) 2084146..2084625 - 480 WP_001287082.1 hypothetical protein -
NW953_RS10175 (NW953_10175) 2084835..2085395 - 561 WP_070004733.1 K(+)-transporting ATPase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2075662..2076426 764


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13441.69 Da        Isoelectric Point: 10.1654

>T254770 WP_000621175.1 NZ_CP102975:c2080263-2079901 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT254770 WP_000948331.1 NZ_CP102975:c2080430-2080260 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References